Recombinant Zygnema circumcarinatum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
ndhC
Target Protein Sequence
MYTLAGYESFWAFLLIASLVPVLAVGTSSLVAPSSKAAEKRTSYESGIEPMGESWIQFQI RYYMFALVFVVFDVETVFLYPWAMSFQQLGVLAFIEALVFVLVLIIGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Zygnema circumcarinatum and why is it important in evolutionary studies?

Zygnema circumcarinatum is a filamentous green alga belonging to the Zygnematophyceae class (ZGA), which has been identified as the closest living relatives of land plants. This evolutionary positioning makes Z. circumcarinatum particularly valuable for understanding the transition from aquatic to terrestrial environments and early land plant evolution .

What is the function of chloroplastic ndhC in photosynthetic organisms?

The ndhC gene encodes the NAD(P)H-quinone oxidoreductase subunit 3, which is a critical component of the chloroplast NADH dehydrogenase-like (NDH) complex involved in cyclic electron flow around photosystem I. Expression analysis in chloroplast genomes reveals that ndhC is among the most highly expressed chloroplast genes in some species, alongside psbJ, rps19, psaJ, and psbA, with FPKM values exceeding 10,000 .

The NDH complex plays a vital role in optimizing photosynthesis by:

  • Facilitating cyclic electron transfer around photosystem I

  • Contributing to ATP synthesis without NADPH production

  • Protecting against photooxidative damage under stress conditions

  • Contributing to CO₂ concentration mechanisms

Table 1: Relative Expression of Highly Expressed Chloroplast Genes in Antarctic hairgrass (Deschampsia antarctica)

GeneFunctionFPKM ValuePercentage of Total Reads
ndhCNADH dehydrogenase subunit>10,000Part of 36.2% (cyclic electron transfer system)
psbJPhotosystem II protein>10,000Part of 29.5% (PSII complex)
rps19Ribosomal protein>10,000-
psaJPhotosystem I protein>10,000-
psbAD1 protein of PSII>10,000Part of 29.5% (PSII complex)

What cultivation methods are recommended for Zygnema circumcarinatum prior to ndhC extraction?

For optimal cultivation of Z. circumcarinatum, researchers should consider the following protocol based on established methodologies:

Axenic cultures should be maintained in Bold's Basal Medium (BBM) or modified BBM under controlled conditions:

  • Light intensity: ~50 μmol photons m⁻² s⁻¹

  • Light/dark cycle: 16/8 hours

  • Temperature: 20°C during light periods, 15°C during dark periods

  • For liquid cultures: maintain on a shaker platform at 110 rpm

  • For solid cultures: use BBM solidified with 1.5% agar with added vitamins

It's crucial to account for the excessive mucilage production in Z. circumcarinatum cultures, which can significantly interfere with extraction procedures. The polysaccharide mucilage contains homogalacturonan pectins and arabinogalactan proteins that help algal filaments form mats and retain water against dehydration—an adaptation to semi-terrestrial environments .

How can researchers overcome challenges in extracting nucleic acids from Zygnema for ndhC gene amplification?

Standard extraction methods often fail with Z. circumcarinatum due to its abundant mucilage. An improved nuclei extraction protocol, modified from Galbraith et al. (1983), has proven successful for genomic work with this organism . This method involves:

  • Carefully removing as much culture medium as possible without disturbing the algal filaments

  • Washing filaments gently with isolation buffer to remove residual medium

  • Chopping the filaments finely in fresh isolation buffer with a sharp razor blade

  • Filtering the homogenate through a series of progressively finer meshes

  • Centrifuging the filtrate to collect nuclei

  • Using detergent treatments to help break down mucilage during extraction

This methodology can be adapted for extracting chloroplast DNA to amplify the ndhC gene. When working with RNA for expression studies, additional RNase inhibitors should be included in the isolation buffer.

What expression systems are recommended for producing recombinant ndhC protein?

While specific expression systems for Z. circumcarinatum ndhC aren't detailed in the search results, researchers might consider adapting proven recombinant protein production systems. For instance, the pKS81 plasmid system developed for gram-positive bacteria offers several advantages:

  • Features a glucose-6-phosphate (G6P) inducible promoter

  • Incorporates an N-terminal secretion signal peptide sequence

  • Includes a C-terminal 8× histidine tag for purification

  • Has demonstrated high yields (up to 900 mg/L) of recombinant proteins

When designing expression constructs for ndhC, researchers should consider:

  • Codon optimization for the host organism

  • Addition of appropriate tags for purification and detection

  • Removal of transit peptide sequences that direct chloroplast localization

  • Potential toxicity of membrane proteins to host cells

How can researchers verify the identity and integrity of recombinant ndhC protein?

Authentication of recombinant ndhC protein should involve multiple analytical approaches:

  • SDS-PAGE analysis: To confirm molecular weight (expected size for ndhC is approximately 13 kDa)

  • Western blotting: Using antibodies specific to ndhC or to affinity tags

  • Mass spectrometry: For peptide mass fingerprinting to confirm protein identity

  • N-terminal sequencing: To verify correct processing of the protein

  • Functional assays: To confirm NADH dehydrogenase activity

Researchers should be aware that plant chloroplast proteins are often subject to post-translational modifications and processing that may not occur correctly in heterologous expression systems, potentially affecting protein function.

What RNA-editing events affect ndhC transcripts and how might this impact recombinant protein studies?

RNA editing is a critical post-transcriptional modification in chloroplasts that can alter the protein-coding sequence. In angiosperms, RNA editing is primarily confined to C-to-U conversions at approximately 30 different positions, while hornworts and ferns exhibit both C-to-U and U-to-C editing at >300 positions .

For ndhC specifically, researchers should be aware that:

  • The conversion rate of C-to-U edits in chloroplast transcripts typically exceeds 90%

  • RNA editing can create codons specifying different amino acids than those encoded by the genomic DNA

  • Tissue-specific, gene-specific, and developmental stage-specific RNA-editing patterns may exist

When producing recombinant ndhC, researchers must decide whether to use the genomic sequence or a sequence reflecting RNA editing events. The choice depends on research objectives and may significantly impact protein structure and function.

How can transcriptome analysis inform our understanding of ndhC expression patterns?

Transcriptome analysis provides valuable insights into ndhC expression patterns and regulation. RNA-seq methodologies can reveal:

  • Absolute expression levels of ndhC relative to other chloroplast genes

  • Environmental conditions that alter ndhC expression

  • Co-expression patterns with functionally related genes

  • RNA processing events including editing and splicing

In Antarctic hairgrass (Deschampsia antarctica), RNA-seq revealed ndhC as one of the most highly expressed chloroplast genes . Similar analyses in Z. circumcarinatum could provide species-specific expression data.

When analyzing RNA-seq data for chloroplast genes, researchers should:

  • Account for the high copy number of chloroplast genomes per cell

  • Consider the possibility of transferring chloroplast gene sequences to the nuclear genome

  • Be aware that small RNAs may regulate chloroplast gene expression

How does the analysis of ndhC contribute to understanding chloroplast genome evolution?

The ndhC gene serves as an important marker for chloroplast genome evolution studies. Comparative genomic analyses reveal several key insights:

  • Presence/absence polymorphisms: While ndhC is present in most land plants and green algae, it has been lost in some lineages, providing evolutionary signals

  • Sequence conservation: The degree of sequence conservation between species reflects evolutionary distance and functional constraints

  • RNA editing patterns: The extent and type of RNA editing in ndhC transcripts varies between plant lineages, offering phylogenetic information

For example, analysis of the chloroplast genomes of prasinophyte green algae revealed that species in clade VI (Prasinococcales) harbor chloroplast genes not previously documented for chlorophytes, including ndhJ, which is functionally related to ndhC . Such discoveries help reconstruct the evolutionary history of photosynthetic organisms.

What insights can ndhC gene expression provide about stress responses in algae?

The expression patterns of ndhC can offer valuable insights into how algae respond to environmental stressors:

  • Upregulation under specific stress conditions may indicate increased demand for cyclic electron flow

  • Co-regulation with other stress-responsive genes suggests functional relationships

  • Changes in RNA editing patterns might fine-tune protein function under stress

How does the function of ndhC differ between aquatic and terrestrial/semi-terrestrial environments?

Zygnematophyceae algae occupy a critical evolutionary position as the closest relatives to land plants, making them ideal for studying adaptations during the water-to-land transition. The function of ndhC may differ between aquatic and terrestrial/semi-terrestrial environments in several ways:

  • Enhanced cyclic electron flow may be more critical in terrestrial environments to deal with fluctuating light conditions

  • Coordination with carbon-concentrating mechanisms might differ between aquatic and terrestrial settings

  • Protection against photooxidative damage becomes increasingly important in terrestrial environments with higher light intensities

Z. circumcarinatum produces sticky polysaccharides that help filaments form mats and retain water against dehydration, an adaptation to semi-terrestrial environments . The association between this adaptation and changes in photosynthetic electron transport (including ndhC function) represents an important area for future research.

What controls should be included when studying recombinant ndhC function?

When designing experiments to study recombinant ndhC function, researchers should include multiple controls:

  • Negative controls:

    • Empty vector expression product

    • Inactivated ndhC protein (site-directed mutagenesis of catalytic residues)

    • ndhC protein with removed targeting sequences

  • Positive controls:

    • Native ndhC protein isolated from chloroplasts (if feasible)

    • Well-characterized NDH proteins from model organisms

  • Comparative controls:

    • ndhC proteins from related species with different ecological niches

    • ndhC variants reflecting different RNA editing states

When measuring electron transport activity, additional controls for substrate specificity, inhibitor sensitivity, and reaction conditions are essential for accurate interpretation of results.

How can researchers address data discrepancies in ndhC genome size and sequence analysis?

Researchers working with Z. circumcarinatum genomic data should be aware of significant discrepancies in the literature regarding genome size and sequence identity. For instance:

  • The nuclear genome size of SAG 698-1a was estimated at 313.2 ± 2.0 Mb by flow cytometry

  • SAG 698-1b was measured at 63.5 ± 0.5 Mb

  • Previous reports for CAUP K402a (supposedly identical to SAG 698-1a) indicated 3.07 ± 0.06 pg DNA content (~3,000 Mb)

To address such discrepancies:

  • Always verify strain identity through both morphological and molecular methods

  • Use multiple technical approaches to confirm genome size estimates

  • Be aware that contamination, polyploidy, or strain misidentification may contribute to discrepancies

  • Consider that methods like protoplast generation for flow cytometry analysis can introduce errors from organellar DNAs

For chloroplast sequence analysis, researchers should note that published chloroplast genomes might not always match the attributed species. For example, the published chloroplast genome of SAG 698-1a shared only 85.69% sequence identity with that of UTEX 1559, suggesting possible mislabeling .

What are the key considerations for designing ndhC-specific primers for gene amplification?

When designing primers for ndhC amplification, researchers should consider:

  • Sequence conservation: Target regions that are conserved within Z. circumcarinatum but differ from other species

  • GC content: Account for the potentially high GC content in algal genomes

  • Secondary structure: Check for potential secondary structures that might inhibit amplification

  • Specificity verification: Test primers against related species to ensure specificity

  • RNA editing sites: For cDNA amplification, be aware of potential RNA editing sites that may cause mismatches

  • Intron positions: While chloroplast genes typically lack introns, verify this for ndhC in Z. circumcarinatum

For phylogenetic studies, target regions should balance conservation (for reliable amplification) with sufficient variation to discriminate between closely related species or strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.