Recombinant Zygnema circumcarinatum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Characteristics

The recombinant ndhE subunit is produced via heterologous expression in Escherichia coli and includes an N-terminal His-tag for purification . Key structural features include:

FeatureDescriptionSource
Accession NumberQ32RM1 (1–100 aa) or Q9MUL4 (1–101 aa)
Molecular Weight~11 kDa (estimated for 100-aa fragment)
Expression SystemE. coli with N-terminal His-tag fusion
TagHis-tag for affinity chromatography
Expression RegionFull-length or partial sequences depending on construct

The protein’s sequence homology with land plant orthologs highlights its evolutionary significance, as Zygnema is a close relative of embryophytes .

Functional Role in Chloroplasts

The ndhE subunit is a component of the NDH complex, which facilitates cyclic electron transport (CET) in chloroplasts. This process generates ATP while minimizing photoinhibition .

Key Functions:

  • Cyclic Electron Transport: Contributes to proton gradient formation for ATP synthesis .

  • Stress Response: Linked to environmental adaptations in Zygnema, such as desiccation tolerance and low-light survival .

  • Evolutionary Adaptation: Orthologs in Zygnema and land plants suggest conserved roles in terrestrialization .

Genomic Context:

  • Strain Variability: Z. circumcarinatum strains (e.g., UTEX 1559, SAG 698-1a) show low sequence identity (85.69%) in their plastomes, indicating genomic rearrangements .

  • Gene Expansions: Zygnema genomes exhibit expansions in stress-related gene families, including those involved in phytohormone signaling and transmembrane transport .

Applications in Biomedical and Agricultural Research

ApplicationDescriptionSource
Protein EngineeringStudying NDH complex assembly and function in photosynthesis
Stress Tolerance StudiesInvestigating desiccation resistance mechanisms in Zygnema
Diagnostic ToolsDevelopment of antibodies/ELISA kits for related chloroplast proteins

Challenges and Future Directions

  • Strain Authentication: Discrepancies in Z. circumcarinatum strain identities (e.g., SAG 698-1a vs. UTEX 1559) complicate genomic comparisons .

  • Functional Elucidation: Limited experimental data on the ndhE subunit’s catalytic role in Zygnema compared to land plants .

Table 2: Genomic Features of Zygnema Strains

StrainPlastome SizeMitogenome SizeSequence IdentitySource
UTEX 1559157,548 bp215,954 bp85.69% vs. SAG 698-1a
SAG 698-1a165,372 bpNot reported

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type requirement, please communicate with us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
ndhE
Target Protein Sequence
MLQNYLCVAAYLFCIGIYGLIISRSMVRALMCLELMLNGVNLNLVAFATYLDNQEIKGQV FAVFIIAIAAAEAAIGLAIVLNIYRNRNSVRVDQFDILKW
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain, and possibly in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.