Recombinant Zygnema circumcarinatum Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
ycf4
Target Protein Sequence
MNIQSDGIRIDLVTGSRRISNLGWASVLLLGTSGFLLTGLSSYLGKDLIPFLYPSEEHMK IAFAPQGLVMCFYGIAGLFLSTYLWCAILWNVGGGYNEFDRQEGTITIFRWGFPGQNRRI RIRCLIKDVKAVRIETQTGLLSRNDISILLRDKQRLVFNQLGDSLTLQEIEDKAVQLAQF LQVPLEGV
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What methodologies can be used to study the interaction between Z. circumcarinatum Ycf4 and PSI components?

    Several sophisticated techniques can be employed to study Ycf4-PSI interactions:

    • Tandem Affinity Purification (TAP): This approach has been successfully used with Chlamydomonas Ycf4 to purify intact Ycf4-containing complexes. The method involves creating a fusion protein with calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site, followed by two-step affinity chromatography .

    • Mass Spectrometry Analysis: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) can identify interacting partners after complex isolation. For Z. circumcarinatum Ycf4, this would likely reveal associations with PSI subunits similar to those identified in Chlamydomonas (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) .

    • Transmission Electron Microscopy and Single Particle Analysis: These techniques can visualize purified Ycf4-containing complexes. Based on studies with Chlamydomonas, the Z. circumcarinatum Ycf4 complex would likely measure approximately 285 × 185 Å .

    • Pulse-Chase Protein Labeling: This technique can reveal the dynamics of PSI polypeptide association with the Ycf4 complex, demonstrating whether newly synthesized PSI components interact with Ycf4 during assembly .

    • Co-immunoprecipitation (Co-IP): Using antibodies specific to Z. circumcarinatum Ycf4 to pull down the protein and its binding partners from thylakoid membrane extracts.

  • How does expression of ycf4 change under desiccation stress in Z. circumcarinatum, and what methodologies best capture these changes?

    Z. circumcarinatum is known for its desiccation tolerance, a key feature for terrestrial habitat colonization. To study ycf4 expression under desiccation:

    • RNA-Seq Analysis: Transcriptomic studies have shown that genes involved in photosynthesis, including those encoding PSI-related proteins, are differentially regulated during desiccation in Z. circumcarinatum. The response is more pronounced in liquid-cultured cells compared to agar-grown cells, which develop better desiccation tolerance .

    • Experimental Design: Optimal experimental approaches include:

      1. Culturing Z. circumcarinatum under controlled conditions (liquid medium vs. agar plates)

      2. Applying desiccation stress at ~86% relative humidity until photosystem II quantum yield (Y(II)) ceases

      3. Monitoring Y(II) using pulse-amplitude modulation fluorometry

      4. Extracting RNA at defined time points for transcriptomic analysis

      5. Using RT-qPCR to validate expression changes of ycf4

    • Physiological Correlates: Culture age significantly affects desiccation tolerance, with older cultures (7-12 months) maintaining photosynthetic activity longer during desiccation than younger cultures (1 month). This should be considered when designing experiments investigating ycf4 expression under stress .

  • What genomic engineering approaches can be used to manipulate ycf4 in Z. circumcarinatum, and what are the technical challenges?

    Chloroplast genome modification in Z. circumcarinatum presents several challenges:

    • Biolistic Transformation: Based on successful approaches with Chlamydomonas, particle bombardment can be used to deliver DNA constructs targeting the ycf4 locus. This requires:

      1. Design of transformation vectors containing selectable markers (e.g., spectinomycin resistance aadA cassette)

      2. Flanking sequences for homologous recombination targeting the ycf4 gene

      3. Optimization of particle bombardment parameters for Z. circumcarinatum

    • Homoplasmy Achievement: Multiple rounds of selection are necessary to achieve homoplasmic transformants where all copies of the chloroplast genome contain the desired modification. Southern blot analysis with ycf4-specific probes can be used to confirm homoplasmy .

    • Complementation Studies: To confirm phenotypes result from ycf4 disruption, complementation with the wild-type gene under control of its native promoter is essential.

    • Technical Challenges:

      1. Lower transformation efficiency compared to model organisms

      2. Selection of appropriate promoters and regulatory elements

      3. Obtaining homoplasmic transformants

      4. Culture conditions that support transformant growth when photosynthesis is impaired

  • How can structural studies of Z. circumcarinatum Ycf4 be conducted, and what insights might they provide?

    Structural studies of Z. circumcarinatum Ycf4 would provide valuable insights into its function:

    • X-ray Crystallography: Requires:

      1. Large-scale expression and purification of recombinant Ycf4 (10-50 mg)

      2. Optimization of crystallization conditions

      3. Stabilization of membrane protein (detergent screening or lipid cubic phase methods)

    • Cryo-Electron Microscopy (Cryo-EM): For studying the entire Ycf4-containing complex:

      1. Affinity purification of intact complexes

      2. Sample vitrification and imaging

      3. Single particle analysis for 3D reconstruction

    Expected structural insights include:

    • Identification of PSI interaction domains

    • Structural basis for the scaffolding function

    • Conformational changes during PSI assembly

    • Comparison with structures from other organisms to understand evolutionary adaptations

    Electron microscopy studies of Chlamydomonas Ycf4 complex revealed particles measuring 285 × 185 Å, suggesting oligomeric states. Similar studies with Z. circumcarinatum Ycf4 would provide comparative structural information .

  • What is the evolutionary significance of Ycf4 conservation in Z. circumcarinatum relative to land plant evolution?

    The evolutionary significance of Ycf4 in Z. circumcarinatum can be investigated through:

    • Phylogenomic Analysis: Zygnematophyceae have been identified as the algal sister lineage to land plants. Comparing ycf4 sequence and function across green algae, Z. circumcarinatum, and land plants can provide insights into photosystem evolution during land colonization .

    • Comparative Functional Studies: Determining whether Z. circumcarinatum Ycf4 can complement ycf4 mutants in other organisms would test functional conservation.

    • Selection Analysis: Calculation of dN/dS ratios across lineages can reveal selective pressures on ycf4.

    • Methodological Approach:

      1. Extract and align ycf4 sequences from diverse photosynthetic organisms

      2. Perform phylogenetic analysis using maximum likelihood and Bayesian methods

      3. Test for gene synteny and genomic context across species

      4. Correlate molecular evolution with physiological adaptations, particularly desiccation tolerance

    This research has significant implications for understanding the evolution of photosynthetic machinery during the water-to-land transition, as the molecular mechanisms of PSI assembly may have been crucial for adaptation to terrestrial environments .

  • How do experimental conditions affect the stability and function of recombinant Z. circumcarinatum Ycf4 in reconstitution experiments?

    The stability and function of recombinant Ycf4 can be affected by various experimental parameters:

    • Buffer Composition: Studies with other Ycf4 proteins suggest optimal conditions include:

      • pH 7.5-8.0 Tris/PBS-based buffer

      • Presence of 5-50% glycerol

      • Mild detergents for membrane protein solubilization (e.g., DDM)

    • Salt Sensitivity: Research on Chlamydomonas Ycf4 complex showed that its stability is salt-sensitive, particularly when the associated protein COP2 is reduced. This suggests ionic strength should be carefully controlled in Z. circumcarinatum Ycf4 experiments .

    • Temperature Effects: Storage recommendations indicate stability at -20°C/-80°C for long-term storage, with working aliquots maintained at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided .

    • Experimental Design for Reconstitution:

      1. Express and purify recombinant Ycf4 with minimal detergent exposure

      2. Isolate thylakoid membranes from ycf4-deficient algae

      3. Reconstitute purified Ycf4 into liposomes or directly with thylakoid membranes

      4. Assess PSI assembly using spectroscopic methods and immunoblotting

      5. Control variables including protein:lipid ratio, buffer composition, and incubation time

    These considerations are crucial for designing experiments that accurately capture the physiological function of Ycf4 in PSI assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.