Recombinant Zygnema circumcarinatum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGVTQSWGGWSITGETVTNAGLWSYEGVAAVHIVLSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHVTGLFGPGVWVSDPYGLTGRVQP VAPAWGAEGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNVETVLSS SIAAVFFAAFVVAGTMWYGCAATPVELFGPTRYQWDQGYFQQEIDRRIRNSVAENVSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDKEGNELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSIEQVGVSVEFYGGELNGVSFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHACFALLFFFGHLWHGSRTLFRDVFA GIDPDLDSQVEFGLFQKLGDPTTRKQTV
Uniprot No.

Target Background

Function
CP47, a core component of Photosystem II (PSII), is involved in the primary light-induced photochemical processes of PSII. It binds chlorophyll and contributes to the catalytic activity of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from water, generating oxygen (O2) and a proton gradient subsequently used for ATP synthesis.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Zygnema circumcarinatum and why is it significant for photosynthesis research?

Zygnema circumcarinatum is a filamentous green alga belonging to the class Zygnematophyceae (ZGA), which has been identified as the closest relative of land plants. This evolutionary position makes it exceptionally valuable for understanding the transition of photosynthetic mechanisms from aquatic to terrestrial environments. Research indicates significant genetic and morphological variation among strains labeled as Z. circumcarinatum, complicating taxonomic classification and research reproducibility .

Notably, molecular studies have revealed that common laboratory strains such as SAG 698-1a and SAG 698-1b, despite being designated as mating types of the same species, show substantial genetic differences in 18S rRNA, psaA, and rbcL genes . This suggests they may actually represent different Zygnema species, with SAG 698-1a showing greater similarity to Z. cylindricum (SAG 698-2) . These taxonomic complications must be considered when studying specific proteins like the CP47 chlorophyll apoprotein.

What is the structure and function of CP47 chlorophyll apoprotein in Photosystem II?

The CP47 chlorophyll apoprotein, encoded by the psbB gene, is an integral membrane protein that serves as an internal antenna complex within Photosystem II (PSII). This protein plays critical roles in:

Structurally, CP47 contains multiple transmembrane domains embedded in the thylakoid membrane, with interconnecting loops extending into the lumen and stroma. The protein's chlorophyll-binding sites are formed by specific amino acid residues that coordinate magnesium atoms at the center of chlorophyll molecules.

Recent research employing quantum mechanics/molecular mechanics (QM/MM) approaches with time-dependent density functional theory has advanced our understanding of chlorophyll excitation energies and structural stability in CP47 . These studies reveal how the protein environment fine-tunes the spectroscopic properties of bound chlorophylls to optimize energy transfer.

How do researchers identify and verify Zygnema strains for psbB studies?

Given the taxonomic confusion within Zygnema species, robust identification protocols are essential for researchers working with psbB. A comprehensive verification approach should include:

Morphological characterization:

  • Cell width and length measurements (e.g., 29-30 μm width observed in Z. insigne)

  • Mucilage layer thickness assessment

  • Chloroplast morphology evaluation

  • Reproductive structure examination when possible

Molecular verification:

  • Multi-gene analysis using established markers:

    • 18S rRNA gene sequencing for broad phylogenetic placement

    • Plastid genes (psaA, rbcL) for resolving relationships within Zygnematophyceae

    • psbA gene analysis for specific phylogenetic placement

Physiological assessment:

  • Photosynthetic parameter measurements (e.g., ETRmax values)

  • Xanthophyll cycle pigment analysis and de-epoxidation state (DEPS) determination

Genomic approach:

  • Nuclear genome size estimation using flow cytometry (e.g., 313.2 ± 2.0 Mb for SAG 698-1a vs. 63.5 ± 0.5 Mb for SAG 698-1b)

  • Whole chloroplast genome sequencing when resources permit

Research has demonstrated that even within cultures labeled as homogeneous, significant morphological variation can occur. For example, when investigating strain SAG 698-1a, researchers isolated eight individual filaments that showed identical sequences for marker genes despite morphological heterogeneity in the culture .

What are the optimal methods for recombinant expression of psbB from Zygnema circumcarinatum?

Successful recombinant expression of the psbB gene from Zygnema circumcarinatum requires specialized approaches due to its multiple transmembrane domains and chlorophyll-binding requirements. Based on current research methods, an optimized protocol should include:

Gene isolation and vector design:

  • Culture Zygnema under standardized conditions (e.g., BBM medium, ~50 μmol photons m–2 s–1, 16/8 light/dark cycle at 20°C)

  • Extract high-quality genomic DNA using methods that overcome the polysaccharide-rich cell walls

  • Amplify the psbB gene with high-fidelity polymerase and gene-specific primers

  • Clone into appropriate expression vectors with consideration of:

    • Codon optimization for the host organism

    • Fusion tags for detection and purification

    • Promoter strength and inducibility

Expression system selection:

  • Photosynthetic hosts (cyanobacteria, Chlamydomonas) for proper cofactor insertion

  • E. coli-based systems with modifications for membrane protein expression

  • Cell-free protein synthesis supplemented with thylakoid membrane mimics

Extraction and purification strategy:

  • Specialized protocols for breaking polysaccharide-rich cell walls

  • Gentle detergent solubilization of membrane proteins

  • Affinity chromatography leveraging fusion tags

  • Size exclusion chromatography for final purity

Functional verification:

  • Absorption spectroscopy to confirm chlorophyll binding

  • Circular dichroism to assess protein folding

  • Activity assays measuring energy transfer capabilities

How can researchers optimize extraction of nuclei and proteins from Zygnema for molecular studies?

Zygnema species present unique challenges for molecular work due to their robust cell walls enriched with sticky and acidic polysaccharides. Standard extraction protocols often yield poor results, necessitating specialized approaches:

Optimized nuclei extraction method:

  • Mechanical disruption of cells by chopping in extraction buffer

  • Filtration through appropriate mesh to remove cell debris

  • Centrifugation to pellet nuclei

  • Purification steps to remove chloroplast and mitochondrial contamination

This approach has proven effective for genome size estimation using flow cytometry, yielding consistent results with low standard deviations (e.g., 313.2 ± 2.0 Mb for SAG 698-1a) .

Membrane protein extraction considerations:

  • Pre-treatment with cell wall-degrading enzymes may improve access to cellular contents

  • Modified buffer compositions with higher detergent concentrations

  • Sequential extraction procedures to maximize yield

  • Quality control at each step using microscopy to monitor cell disruption

Table 1: Comparative Efficiency of Extraction Methods for Zygnema

Extraction MethodApplicationAdvantagesLimitationsReference
Mechanical choppingNuclei isolationPreserves nuclear integrity, Low contaminationLabor-intensive
Protoplast generationFlow cytometryTraditional approachPotential interference from pigments and organelles
Bead-beatingProtein extractionHigh yieldPotential protein degradation-
Freeze-thaw cyclesDNA/RNA extractionSimple procedureVariable efficiency-
Enzymatic digestionProtein extractionGentle cell disruptionTime-consuming, expensive-

What analytical techniques are most effective for studying chlorophyll-protein interactions in recombinant CP47?

Understanding chlorophyll-protein interactions in recombinant CP47 requires a combination of biophysical, spectroscopic, and computational approaches:

Spectroscopic methods:

  • Absorption spectroscopy to characterize bound chlorophylls

  • Circular dichroism to assess protein secondary structure

  • Fluorescence spectroscopy to measure energy transfer

  • Resonance Raman spectroscopy for vibration modes of chlorophyll-protein interactions

Advanced biophysical techniques:

  • Time-resolved fluorescence spectroscopy to track energy transfer kinetics

  • Transient absorption spectroscopy for ultrafast processes

  • Single-molecule FRET to examine conformational dynamics

  • Small-angle X-ray scattering for solution structure

Structural methods:

  • X-ray crystallography for high-resolution structures (challenging for membrane proteins)

  • Cryo-electron microscopy for near-native structural determination

  • NMR spectroscopy for specific interaction mapping

Computational approaches:

  • Quantum mechanics/molecular mechanics (QM/MM) simulations

  • Molecular dynamics to explore conformational flexibility

  • Density functional theory calculations for spectroscopic property prediction

Recent applications of QM/MM approaches utilizing time-dependent density functional theory have proven particularly valuable for studying chlorophyll excitation energies and structural stability of CP47 in PSII . These computational methods help bridge the gap between experimental spectroscopic measurements and structural data.

How does phylogenetic analysis of psbB contribute to understanding Zygnema taxonomy?

The psbB gene provides valuable phylogenetic information that complements other molecular markers used in Zygnema taxonomy:

Phylogenetic utility of psbB:

  • Moderate evolutionary rate suitable for genus-level distinctions

  • Conserved functional domains provide reliable alignment positions

  • Presence in the chloroplast genome facilitates comparison with other plastid markers

Methodological approach:

  • Sequence alignment optimization with attention to conserved domains

  • Tree reconstruction using multiple methods:

    • Maximum parsimony (MP)

    • Maximum likelihood (ML)

    • Bayesian analyses (BA)

  • Evaluation of node support through bootstrap and posterior probability values

Integration with multi-marker phylogenies:
Research has shown that analyzing multiple genes provides more robust phylogenetic resolution. For example, studies of Korean Zygnema species utilized psbA sequences alongside morphological data to distinguish species like Z. insigne and Z. leiospermum . Similarly, assessment of SAG 698-1a and SAG 698-1b employed 18S rRNA, psaA, and rbcL sequences to reveal their placement in different phylogenetic clades .

The sequence divergence observed in these marker genes can be substantial. For instance, psbA sequence divergence between Z. insigne and Z. leiospermum ranged from 3.7 to 4.1%, while comparison between Z. circumcarinatum and Z. leiospermum showed even greater divergence (5.3-5.9%) .

What does the study of CP47 reveal about the evolution of photosynthesis from algae to land plants?

CP47 represents an evolutionarily conserved component of Photosystem II whose study provides insights into the adaptation of photosynthetic machinery during the transition from aquatic to terrestrial environments:

Evolutionary significance:

  • Zygnematophyceae position as closest algal relatives to land plants makes their photosynthetic proteins particularly informative for understanding terrestrialization

  • CP47 structure and function represent ancestral states that can be compared to land plant counterparts

Evolutionary patterns observed:

  • Core structural elements show high conservation across green algae and land plants

  • Specific adaptations in land plant CP47 may reflect adjustments to terrestrial light conditions

  • Interaction surfaces with other PSII components reveal co-evolutionary patterns

Research implications:

  • Comparing CP47 from various Zygnema species with early land plant lineages can identify key innovations

  • Structural models based on recombinant proteins enable mapping of evolutionary changes to functional consequences

  • Experimental characterization of photosynthetic efficiency under varying conditions may reveal selection pressures

The genomic context of psbB also provides evolutionary insights. Analysis of whole chloroplast genomes from different strains (e.g., SAG 698-1a vs. UTEX 1559) has revealed substantial sequence divergence (only 85.69% identity), supporting the reassessment of taxonomic relationships within Zygnema .

How does CP47 diversity among Zygnema strains inform our understanding of photosystem adaptation?

The diversity in CP47 protein sequences among Zygnema strains provides a natural laboratory for studying photosystem adaptation to specific environmental conditions:

Strain-specific adaptations:

  • Variations in chlorophyll-binding residues may fine-tune light harvesting properties

  • Differences in transmembrane domains can affect stability in various membrane environments

  • Loop region modifications might influence interactions with other photosystem components

Functional implications:

  • Physiological measurements reveal distinct photosynthetic parameters between strains

  • ETRmax values differ significantly between closely related strains after standardized cultivation periods

  • Xanthophyll cycle pigment composition and de-epoxidation state (DEPS) show strain-specific patterns

Methodological approaches:

  • Comparative sequence analysis to identify variant regions

  • Homology modeling to predict structural consequences

  • Recombinant expression of variant proteins for functional characterization

  • Site-directed mutagenesis to test the significance of specific residues

By understanding how natural variation in CP47 affects photosystem function, researchers can identify key adaptations that contributed to the evolutionary success of different lineages. This knowledge also informs bioengineering efforts aimed at optimizing photosynthesis for various applications.

How can researchers resolve contradictions in experimental data when working with recombinant CP47?

Working with recombinant CP47 from Zygnema species often produces contradictory experimental results due to taxonomic confusion, protein complexity, and technical challenges. A systematic approach to resolving such contradictions includes:

Strain verification:

  • Verify the taxonomic identity of source material through multi-marker molecular analysis

  • Document morphological characteristics

  • Consider nuclear genome size as a verification parameter (e.g., 313.2 Mb for SAG 698-1a vs. 63.5 Mb for SAG 698-1b)

Methodological triangulation:

  • Apply multiple independent techniques to address the same question

  • Compare results from different expression systems

  • Validate findings using complementary analytical approaches

Experimental standardization:

  • Maintain consistent growth conditions (medium, light, temperature)

  • Standardize protein extraction and purification protocols

  • Implement rigorous quality control at each experimental stage

Critical experiment design:

  • Identify specific contradictions in existing data

  • Formulate testable hypotheses to explain discrepancies

  • Design experiments specifically targeting the source of contradiction

  • Include appropriate controls for all variables

Data integration framework:

  • Develop explicit criteria for weighing conflicting evidence

  • Consider biological explanations (post-translational modifications, conformational states)

  • Implement statistical approaches for reconciling divergent measurements

The case of SAG 698-1a illustrates the importance of thorough verification. Research revealed that this strain, widely used in previous studies, might have been confused with Z. cylindricum (SAG 698-2) prior to 2005 . This discovery helps explain contradictory results in earlier literature and emphasizes the need for comprehensive strain characterization.

What quality control measures are essential for recombinant CP47 research?

Ensuring the quality, integrity, and functionality of recombinant CP47 requires rigorous quality control throughout the experimental pipeline:

Source material quality control:

  • Verify strain identity through molecular markers

  • Maintain axenic cultures

  • Document growth conditions precisely

Expression verification:

  • Confirm successful transcription through RT-PCR

  • Validate protein expression by Western blotting

  • Assess membrane integration

Purification quality metrics:

  • Purity assessment via multiple methods:

    • SDS-PAGE with various staining techniques

    • Size exclusion chromatography profiles

    • Mass spectrometry for identity confirmation

  • Structural integrity validation:

    • Circular dichroism for secondary structure

    • Thermal stability measurements

    • Limited proteolysis resistance

Functional validation:

  • Absorption spectroscopy to confirm chlorophyll binding

  • Fluorescence measurements to assess energy transfer

  • Comparative analysis with native protein when possible

Storage stability testing:

  • Evaluate different storage conditions

  • Monitor time-dependent changes in structural and functional parameters

  • Implement standardized protocols for handling between experiments

Establishing quantitative acceptance criteria for each quality parameter enables objective decision-making about sample usability and facilitates troubleshooting when quality issues arise.

How can computational approaches enhance understanding of CP47 structure-function relationships?

Computational methods offer powerful tools for investigating CP47 structure-function relationships, especially given the experimental challenges associated with membrane proteins:

Homology modeling workflow:

  • Identify suitable templates from related organisms

  • Generate sequence alignments optimized for transmembrane regions

  • Build multiple models using different algorithms (MODELLER, Rosetta, AlphaFold2)

  • Refine models through energy minimization in a membrane environment

  • Validate models using membrane protein-specific scoring functions

Molecular dynamics applications:

  • Simulate protein behavior in various membrane compositions

  • Investigate chlorophyll-protein interactions over time

  • Identify water molecules and their role in protein function

  • Calculate free energy landscapes to identify stable conformations

Quantum mechanical approaches:

  • Apply QM/MM methods to model chlorophyll excitation energies

  • Calculate electronic coupling between chromophores

  • Predict spectroscopic properties based on structural models

  • Model energy transfer pathways

Structure-based prediction:

  • Predict the impact of sequence variations between strains

  • Identify functionally important residues through conservation analysis

  • Design site-directed mutagenesis experiments based on computational insights

Integration with experimental data:

  • Refine computational models using spectroscopic constraints

  • Design critical experiments to validate computational predictions

  • Develop integrative visualization tools that combine multiple data types

These computational approaches are particularly valuable for studying proteins like CP47 from Zygnema circumcarinatum, where experimental challenges may limit traditional structural biology approaches.

What emerging technologies are advancing research on recombinant photosystem proteins?

Emerging technologies are revolutionizing research on recombinant photosystem proteins, including CP47 from Zygnema circumcarinatum:

Advanced expression systems:

  • Cell-free protein synthesis optimized for membrane proteins

  • Synthetic biology approaches with redesigned genetic circuits

  • CRISPR-Cas9 engineered photosynthetic hosts

Innovative purification strategies:

  • Styrene maleic acid lipid particles (SMALPs) for native membrane environment preservation

  • Nanodiscs and peptidiscs for membrane protein stabilization

  • Automated purification platforms with real-time quality monitoring

High-resolution structural analysis:

  • Cryo-electron microscopy advances for membrane protein structure determination

  • Serial femtosecond crystallography using X-ray free-electron lasers

  • Integrative structural biology combining multiple experimental inputs

Functional characterization technologies:

  • Advanced microscopy techniques:

    • Single-molecule fluorescence resonance energy transfer

    • Super-resolution microscopy

    • High-speed atomic force microscopy

  • Ultrafast spectroscopy:

    • Two-dimensional electronic spectroscopy

    • Pump-probe spectroscopy with femtosecond resolution

  • Artificial intelligence approaches for data analysis and interpretation

These technologies collectively enhance our ability to express, purify, and characterize challenging membrane proteins like CP47, accelerating progress in understanding photosynthetic processes.

How might understanding CP47 from Zygnema contribute to applied photosynthesis research?

Research on CP47 from Zygnema circumcarinatum has significant implications for applied photosynthesis research:

Fundamental insights with practical applications:

  • Understanding energy transfer efficiency mechanisms

  • Elucidating structural adaptations to different light environments

  • Identifying determinants of protein-pigment complex stability

Potential applications:

  • Bioengineering enhanced photosynthesis:

    • Informed modification of antenna proteins for improved light capture

    • Optimization of energy transfer pathways

    • Engineering stress tolerance into photosynthetic machinery

  • Biomimetic solar energy systems:

    • Design principles for artificial light-harvesting complexes

    • Development of bio-inspired photovoltaic components

    • Strategies for self-assembly of functional protein-pigment arrays

  • Environmental adaptation research:

    • Insights into mechanisms of photosynthetic adaptation to changing environments

    • Identification of genetic targets for improving crop resilience

    • Understanding evolutionary constraints on photosynthetic efficiency

The evolutionary position of Zygnema as a close relative to land plants makes its photosynthetic components particularly relevant for understanding the fundamental adaptations that enabled the terrestrialization of photosynthetic organisms, with potential applications in improving crop photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.