Recombinant Zygnema circumcarinatum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

PsbA (D1) is integral to PSII’s structure and function:

  • QB Binding: Facilitates electron transfer from QA to QB, enabling plastoquinone reduction .

  • Photodamage Repair: Undergoes rapid turnover under high light due to oxidative damage .

  • Oxygen Evolution: Part of the water-splitting complex .

In Zygnema circumcarinatum, PsbA’s role is evolutionarily conserved, with sequence homology to cyanobacterial and plant counterparts .

3.2. Biotechnological Tools

  • Antibody Production: Serves as a quantitation standard for Western blotting using global anti-PsbA antibodies .

  • Photosynthetic Efficiency: Engineered variants improve stress tolerance in algae and crops .

Genomic and Evolutionary Insights

  • Gene Regulation: Zygnema’s psbA is chloroplast-encoded, with transcription modulated by light intensity and redox state .

  • Genome Streamlining: Z. circumcarinatum has a compact nuclear genome (63.5–313.2 Mb), high coding density, and low repeat content, facilitating PsbA studies .

Challenges and Future Directions

  • Stability Issues: Recombinant PsbA requires glycerol and strict storage conditions to prevent aggregation .

  • Functional Hybrids: Research focuses on integrating Zygnema PsbA into cyanobacterial/chimeric PSII to study adaptation mechanisms .

Key Research Findings

StudyFindingSource
PsbA mRNA TranslationLPE1 protein binds psbA 5’UTR to regulate D1 synthesis in Arabidopsis
Gene Family DynamicsCyanobacteria use multiple psbA isoforms for light adaptation
Z. circumcarinatum GenomicsStrain SAG 698-1b has a 63.5 Mb genome with streamlined coding regions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is preferred, please communicate this requirement in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
psbA
Target Protein Sequence
MTATLERRESASLWGRFCDWVTSTENRLYIGWFGVIMIPTLLTATSVFIIAFIAAPPVDI DGIREPVAGSLLFGNNIISGAIVPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVCCYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently utilized for ATP formation. It comprises a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Photosystem Q(B) protein (psbA) and what is its role in Z. circumcarinatum?

    The Photosystem Q(B) protein, also known as D1 protein, is a critical component of the photosystem II (PSII) reaction center encoded by the chloroplast psbA gene. In Z. circumcarinatum, as in other photosynthetic organisms, this 344-amino acid protein (UniProt ID: Q32RM3) forms part of the core of PSII and participates in the water-splitting reaction of oxygenic photosynthesis .

    D1 is particularly significant because it contains binding sites for many of the cofactors involved in the electron transport chain, including the manganese cluster where water oxidation occurs. Due to its central role in photosynthesis and its exposure to strongly oxidative chemistry during water splitting, the D1 protein experiences constant photodamage requiring frequent replacement .

  • How is the psbA gene typically structured and regulated in algal species like Zygnema?

    The psbA gene organization in Zygnema follows patterns observed in other green algae but with species-specific characteristics. While detailed information specifically for Z. circumcarinatum is limited, research on related species reveals that:

    • The gene encodes the full-length 344 amino acid D1 protein

    • In algae, psbA sequences are frequently used for phylogenetic analysis due to their conserved yet variable regions

    • The pairwise divergence between Zygnema species ranges from 3.7-4.1% (34-38 bp) in psbA sequences

    Regulation of psbA gene expression typically involves:

    • Light-responsive elements in the promoter region

    • Various sigma factors that recognize specific hexameric −35 and −10 regions in the promoter

    • Chromatin structure and cis-acting elements surrounding the transcription start site

    • Post-transcriptional mechanisms affecting mRNA stability and translation efficiency

  • What methods are recommended for handling recombinant Z. circumcarinatum psbA protein in laboratory settings?

    Based on commercial protocols for recombinant Z. circumcarinatum Photosystem Q(B) protein, the following handling recommendations should be observed:

    Reconstitution Protocol:

    • Centrifuge vial briefly prior to opening

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended default: 50%) for long-term storage

    Storage Conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquot for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Use Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 for storage

    Quality Control:

    • Verify purity (>90%) using SDS-PAGE before experimental use

  • How does the phylogenetic placement of Z. circumcarinatum psbA relate to other photosynthetic organisms?

    Phylogenetic analysis of the psbA gene has been instrumental in elucidating evolutionary relationships among green algae. For Zygnema specifically:

    • Analysis of psbA sequences revealed the monophyly of Z. insigne and Z. leiospermum together with Z. circumcarinatum isolates from Germany and Scotland

    • The protein sequence shows evolutionary conservation with other photosynthetic organisms while maintaining species-specific variations

    • Z. circumcarinatum belongs to the Zygnematophyceae class, which has been identified as the algal sister lineage to land plants

    • Comparative studies using psbA have helped distinguish between different strains of Z. circumcarinatum (e.g., SAG 698-1b, UTEX 1559), confirming their taxonomic placement

Advanced Research Questions

  • What strategies can be employed for expressing and purifying recombinant Z. circumcarinatum psbA protein for structural studies?

    Successful expression and purification of recombinant Z. circumcarinatum psbA protein requires addressing several challenges related to its membrane-bound nature:

    Expression Strategies:

    • Heterologous expression in E. coli with an N-terminal His-tag has proven effective

    • Use of full-length construct (1-344 amino acids) rather than truncated versions maintains structural integrity

    • Codon optimization for the expression host improves yield

    • Expression systems with strong inducible promoters (T7) provide better control

    Purification Protocol:

    • Affinity chromatography using the His-tag on nickel columns

    • Buffer optimization containing mild detergents to maintain protein solubility

    • Additional purification steps may include ion exchange or size exclusion chromatography

    • Final purification >90% can be verified by SDS-PAGE

    Stabilization Considerations:

    • Addition of glycerol (5-50%) for long-term storage

    • Lyophilization with stabilizers (6% Trehalose) preserves protein activity

    • Avoiding repeated freeze-thaw cycles

    • Storage in appropriate buffers (Tris/PBS-based, pH 8.0)

  • How do regulatory mechanisms of psbA gene expression in Z. circumcarinatum respond to environmental stressors?

    While specific regulatory mechanisms for Z. circumcarinatum are not fully characterized, research on related photosynthetic organisms provides insight into likely regulatory patterns:

    Light Intensity Regulation:

    • Different D1 isoforms are expressed under varying light conditions in cyanobacteria

    • Under high light, there is typically increased turnover of D1 protein and upregulation of specific psbA genes

    • The thiol redox state appears to be a key regulator of psbA gene expression rather than the plastoquinone pool redox state

    Wavelength-Specific Responses:

    • Blue light can induce transcription of specific psbA genes

    • This induction can be reversed by subsequent exposure to red light, suggesting photoreceptor-mediated regulation

    Stress Response Mechanisms:

    • Temperature, UV radiation, and nutrient availability affect expression patterns

    • Oxidative stress triggers increased D1 turnover and psbA expression

    • Regulatory proteins bind to specific regions of psbA genes in response to stress conditions

    RNA-Protein Interactions:

    • RNA-binding proteins interact with the 5′ UTR of psbA mRNA to regulate translation

    • In Arabidopsis, proteins like LPE1 bind to psbA mRNA in a light-dependent manner through redox-based mechanisms

  • What comparative genomic approaches are most effective for studying psbA evolution across Zygnema species?

    Several genomic approaches have proven valuable for evolutionary studies of psbA in Zygnema and related species:

    Sequence-Based Methods:

    • Whole chloroplast genome sequencing allows comprehensive analysis of gene context and synteny

    • Analysis of synonymous vs. non-synonymous substitution rates reveals selection pressures

    • Identification of conserved domains indicates functionally critical regions

    Phylogenetic Approaches:

    • Maximum likelihood and Bayesian analyses of psbA sequences provide robust evolutionary trees

    • Analysis of the pairwise sequence divergence (3.7-4.1% between some Zygnema species)

    • Inclusion of multiple strains captures intraspecific variation (e.g., SAG 698-1a, SAG 698-1b, UTEX 1559, UTEX 1560)

    Structural Analysis:

    • Comparison of gene order and rearrangements across chloroplast genomes

    • Analysis of intergenic regions and repeats (non-overlapping repeats constitute approximately 1.4% of intergenic regions in some charophycean green algae)

    • Detection of horizontal gene transfer events

    Functional Conservation Studies:

    • Identification of conserved regulatory elements across species

    • Analysis of expression patterns of psbA genes under different conditions

    • Comparative analysis of D1 protein function across species

  • What experimental systems can be used to study psbA gene expression in Z. circumcarinatum?

    Several experimental approaches can be employed to study psbA gene expression in Z. circumcarinatum:

    Reporter Gene Systems:

    • Construction of chimeric genes with the psbA promoter driving reporter gene expression

    • Similar approaches to those used for studying regulation of apoCP47 synthesis can be applied

    • GFP or luciferase reporters allow real-time monitoring of expression

    RNA Analysis Techniques:

    • Quantitative RT-PCR for measuring transcript levels under different conditions

    • RNA-seq for genome-wide expression analysis

    • Northern blotting for specific detection of psbA transcripts and their stability

    • 5′ RACE to identify transcription start sites and characterize UTRs

    Protein Analysis Methods:

    • Pulse-chase labeling to study protein synthesis and turnover rates

    • Western blotting with specific antibodies against D1 protein

    • Mass spectrometry to identify post-translational modifications

    • Blue-native PAGE to analyze protein complexes containing D1

    Genetic Manipulation:

    • Targeted mutagenesis strategies similar to those used in C. reinhardtii could be adapted

    • Chloroplast transformation via particle bombardment with homologous recombination

    • CRISPR-Cas systems for targeted modifications of nuclear regulators

  • What are the structural and functional differences between D1 protein isoforms in photosynthetic organisms and their implications for Z. circumcarinatum research?

    D1 protein isoforms exhibit important differences that affect photosystem II function across species:

    Isoform Classification:

    IsoformExpression PatternFunctional Characteristics
    D1:1Predominant under normal/low light conditionsOptimized for efficient light capture
    D1:2Induced under high light/stressEnhanced photoprotection, increased tolerance to oxidative damage
    D1mConstitutively expressed in some speciesIntermediate properties
    D1'Expressed under microaerobic/low oxygenSpecialized for low-oxygen conditions

    Amino Acid Substitutions:

    • Key substitutions in the D1:2 isoform (particularly at positions in the QB binding pocket) affect electron transfer kinetics

    • These modifications alter PSII photochemistry and confer different stress tolerance properties

    Expression Patterns:

    • In cyanobacteria under low light, >80% of psbA transcripts come from genes encoding D1:1

    • Under high light stress, transcription shifts to favor genes encoding D1:2

    • High light-acclimated cells show greater resistance to UV radiation compared to low/medium light-acclimated cells

    Research Implications:

    • Understanding which isoforms exist in Z. circumcarinatum would inform stress adaptation studies

    • Identifying regulatory mechanisms controlling isoform switching could reveal evolutionary adaptations

    • Comparative studies between Z. circumcarinatum and other species could provide insights into photosynthetic optimization strategies

  • How can site-directed mutagenesis of the Z. circumcarinatum psbA gene be used to study D1 protein function?

    Site-directed mutagenesis offers powerful tools for understanding structure-function relationships in the D1 protein:

    Methodological Approaches:

    • Homologous recombination-based techniques similar to those established for C. reinhardtii can be adapted

    • Transformation via particle bombardment using constructs with mutated psbA sequences flanked by homologous regions

    • Selection strategies may utilize photosynthetic competence or antibiotic resistance markers

    Strategic Target Sites:

    • QB binding pocket mutations to alter herbicide binding or electron transfer kinetics

    • D1-D2 interface residues to study dimer formation and stability

    • Manganese-binding cluster residues to investigate water oxidation

    • Mutation of residues differing between D1:1 and D1:2 isoforms to understand stress adaptation

    Functional Analysis:

    • Chlorophyll fluorescence measurements to assess PSII quantum yield

    • Oxygen evolution assays to evaluate water-splitting activity

    • Herbicide binding studies to analyze QB pocket alterations

    • Electron transport rate measurements using artificial electron acceptors

    • Thermal/light stability assays to assess stress tolerance of mutants

    Potential Applications:

    • Engineering enhanced photosynthetic efficiency or stress tolerance

    • Understanding evolutionary adaptations in the photosynthetic apparatus

    • Developing D1 variants resistant to photoinhibition

  • What factors influence the translation efficiency of psbA mRNA in Zygnema and related species?

    Translation of psbA mRNA is regulated by multiple factors that fine-tune D1 protein synthesis:

    RNA Structural Elements:

    • The 5′ untranslated region (UTR) contains regulatory elements that influence translation efficiency

    • Stem-loop structures and sequence motifs in the UTR serve as binding sites for regulatory proteins

    • The Shine-Dalgarno sequence and its context affect ribosome recruitment

    RNA-Binding Proteins:

    • In higher plants, PPR proteins like LPE1 bind to the 5′ UTR of psbA mRNA in a light-dependent manner

    • LPE1 facilitates the association of other factors like HCF173 with psbA mRNA to regulate translation

    • This regulation operates through a redox-based mechanism responsive to light conditions

    Translational Autoregulation:

    • Unassembled D1 protein can exert negative feedback on its own synthesis

    • This regulation is mediated by the 5′ UTR of psbA mRNA

    • This mechanism helps coordinate protein synthesis with assembly of functional PSII complexes

    Environmental Cues:

    • Light intensity directly influences translation efficiency

    • Temperature affects both mRNA stability and translation rate

    • The redox state of the chloroplast regulates translation through multiple mechanisms

    • Recovery from photoinhibition involves increased translation of psbA mRNA in response to D1 degradation

  • What are the NIH guidelines for experiments involving recombinant Z. circumcarinatum psbA?

    Research involving recombinant Z. circumcarinatum psbA must follow specific NIH guidelines:

    Exempt Experiments:
    Certain experiments may be exempt from the NIH Guidelines if they involve:

    • Synthetic nucleic acids that:

      1. Can neither replicate nor generate nucleic acids that can replicate in any living cell

      2. Are not designed to integrate into DNA

      3. Do not produce a toxin lethal for vertebrates at an LD50 of less than 100 ng/kg body weight

    • Nucleic acids not in organisms, cells, or viruses and not modified to penetrate cellular membranes

    • Nucleic acids consisting solely of the exact recombinant sequence from a single source existing in nature

    Non-Exempt Experiments:
    Experiments are not exempt if they involve:

    • Deliberate transfer of drug resistance traits to microorganisms not known to acquire them naturally

    • Formation of recombinant molecules containing genes for vertebrate toxins with LD50 <100 ng/kg

    • Deliberate transfer into human research participants of nucleic acids meeting certain criteria

    Institutional Review Requirements:

    • Even potentially exempt experiments may require review by Institutional Biosafety Committees (IBCs)

    • Large-scale experiments (>10 liters culture volume) require additional oversight

    • Special considerations apply if modified organisms will be released into the environment

    Compliance Recommendations:

    • Consult institutional biosafety officers early in experimental planning

    • Document risk assessment for all recombinant DNA experiments

    • Submit protocols for IBC review when required

    • Contact NIH Office of Science Policy (NIHguidelines@od.nih.gov) with questions about guidelines

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.