Recombinant Zygnema circumcarinatum Probable sulfate transport system permease protein cysT (cysT)

Shipped with Ice Packs
In Stock

Description

Gene Arrangement and Transcriptional Regulation

  • Operon Structure: In cyanobacteria, sulfate transport genes (e.g., sbpA-cysT-cysW-cysA) form a single operon. While Zygnema’s plastid genome lacks cysT, nuclear genomes retain cysT and cysA homologs .

  • Upstream Motifs: A conserved TAAWATGATT motif is present near cysT promoters in green algae, suggesting shared regulatory mechanisms with cyanobacteria .

  • Gene Neighbors: rpl32 (ribosomal protein L32) is upstream of cysT in most Zygnema strains, though exceptions exist (e.g., Chlorokybus atmophyticus) .

Phylogenetic Conservation

CysT proteins exhibit high conservation across green algae, cyanobacteria, and proteobacteria, reflecting their ancestral role in sulfate assimilation. Structural variations include truncated C-termini in Bryopsis hypnoides and Leptosira terrestris .

Mechanism of Action

The cysT permease facilitates sulfate import via an ATP-dependent mechanism. In Zygnema:

  1. Substrate Binding: A periplasmic sulfate-binding protein (e.g., sbpA) binds sulfate.

  2. Membrane Transport: cysT and cysW form a channel for sulfate translocation.

  3. Energy Coupling: cysA hydrolyzes ATP to drive transport .

Biological Relevance

  • Sulfur Metabolism: Sulfate transport is essential for synthesizing reduced sulfur compounds (e.g., cysteine) and defense molecules .

  • Stress Response: Sulfate uptake may mitigate chromium toxicity by competing with chromate ions and enhancing sulfur availability .

Recombinant Expression

The cysT protein is produced via heterologous expression in E. coli, enabling structural and functional studies:

ParameterDetail
Expression SystemE. coli with T7 promoter-driven expression
Purification MethodAffinity chromatography (His-tag)
PurityHigh-purity recombinant protein suitable for biochemical assays

Research Applications

  • Structural Biology: Studies on cysT’s transmembrane domains and interactions with cysW/cysA.

  • Functional Assays: Kinetic analysis of sulfate/thiosulfate transport efficiency.

  • Evolutionary Studies: Comparative analysis of sulfate transporters in Zygnematophyceae vs. land plants .

Research Gaps and Future Directions

  1. Functional Validation: Direct evidence of cysT’s role in sulfate assimilation in Zygnema remains limited.

  2. Regulatory Networks: Elucidating transcription factors (e.g., CysB homologs) controlling cysT expression.

  3. Comparative Genomics: Investigating how Zygnema’s sulfate transporters differ from those in land plants .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cysT; Probable sulfate transport system permease protein cysT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Zygnema circumcarinatum (Green alga)
Target Names
cysT
Target Protein Sequence
MILLCVISRTVLLNIRKRDIRFFTYFEFLLIAALHYGILILFLPVTALLLRTKEQSWYTI FQAVTEPVVLSAYKVTFLTAALAAVINAFLGLILAWILVRYRFPGKNFLDAAVDLPFALP TSVGGLTLMTVYSDKGWMGPICSWLGIKIAFSRLGVLIAMMFVSLPFIVRTIQPVLQSME EETEEAAWCIGASPWTTFWNVLFPPMISPLLTGTALGFSRAIGEYGSIVLVASNIPMKDL VVSVLIFQRLEQYDYKGATAIASVVLLVSFAILLIINYIYLKRKSLTR
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex cysAWTP (TC 3.A.1.6.1), involved in sulfate/thiosulfate import. It is likely responsible for the translocation of the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the cysT gene in Zygnema circumcarinatum and what does it encode?

The cysT gene in Zygnema circumcarinatum encodes a probable sulfate transport system permease protein that functions as an integral membrane component of the sulfate uptake system. This protein is predicted to contain multiple transmembrane domains and forms part of a channel through which sulfate ions can pass across the cytoplasmic membrane. In cyanobacteria such as Synechococcus, the homologous CysT protein is 278 amino acids in length with a calculated molecular mass of approximately 30.4 kDa and contains a high percentage (61.5%) of nonpolar amino acids, which is typical of membrane transport proteins . While specific characterization of the Z. circumcarinatum CysT is still ongoing, comparative genomic analyses suggest similar structural features and functions to those established in other photosynthetic organisms.

How is the sulfate transport system organized in Zygnema species?

The sulfate transport system in Zygnema species follows the general organization found in many photosynthetic organisms, comprising multiple components that work together to facilitate sulfate uptake. The system typically includes:

  • A periplasmic sulfate-binding protein (SbpA) that captures sulfate from the external environment

  • Two transmembrane channel-forming proteins (CysT and CysW) embedded in the cytoplasmic membrane

  • An ATP-binding protein (CysA) that provides energy for active transport through ATP hydrolysis

This organization has been confirmed in the chloroplast genome of Zygnema (GenBank: AY958086), which contains both cysA and cysT genes, while these genes are notably absent in the related alga Staurastrum . The components work together as follows: SbpA binds sulfate in the periplasmic space, delivers it to the CysT/CysW channel complex, and CysA hydrolyzes ATP to drive the active transport of sulfate across the membrane against its concentration gradient.

What techniques are used to identify and characterize the cysT gene in Zygnema circumcarinatum?

Several complementary techniques are employed to identify and characterize the cysT gene in Zygnema circumcarinatum:

  • Genome sequencing and annotation: High-throughput sequencing of the chloroplast and nuclear genomes, followed by computational annotation to identify the cysT gene based on sequence homology with known sulfate transporters .

  • PCR amplification and Sanger sequencing: Using specific primers designed from conserved regions of cysT to amplify the gene, followed by sequence verification .

  • RNA-seq and transcriptome analysis: To determine expression patterns and confirm the transcription of the cysT gene under different sulfur availability conditions .

  • Phylogenetic analysis: Comparing the cysT sequence across different Zygnema strains and related algae to understand evolutionary relationships and confirm strain identity .

  • Function prediction: Using bioinformatics tools to predict protein structure, transmembrane domains, and functional motifs based on amino acid sequence .

These approaches have been critical in sorting out strain identification issues, as demonstrated in studies comparing different Zygnema strains like SAG 698-1a and SAG 698-1b, which were found to represent different species despite their historical classification .

What methods are most effective for expressing recombinant Zygnema cysT for structural and functional studies?

Expressing recombinant membrane proteins like CysT presents significant challenges. For Zygnema cysT, researchers should consider these specialized approaches:

  • Expression system selection:

    • E. coli-based systems: Modified strains optimized for membrane protein expression (C41/C43, Lemo21) with careful consideration of codon optimization for the algal gene

    • Yeast systems: Pichia pastoris or Saccharomyces cerevisiae for eukaryotic processing capabilities

    • Algal expression systems: Homologous expression in closely related species like Chlamydomonas for maintaining native folding environments

  • Fusion tag strategies:

    • N-terminal tags (His6, MBP, or SUMO) to facilitate detection and purification

    • Fluorescent protein fusions (GFP, YFP) to monitor expression and localization

    • Cleavable tags that can be removed after purification for structural studies

  • Solubilization and purification protocols:

    • Screening multiple detergents (DDM, LDAO, C12E8) for optimal solubilization

    • Nanodiscs or amphipol reconstitution for maintaining native-like lipid environments

    • Affinity chromatography followed by size exclusion for purification

  • Functional characterization approaches:

    • Reconstitution into proteoliposomes for transport assays

    • Complementation studies in cysT-deficient bacterial or yeast mutants

    • Electrophysiological measurements using patch clamp or solid-supported membrane techniques

For crystallization studies, strategies such as limited proteolysis to remove flexible regions, antibody fragment co-crystallization, or lipidic cubic phase crystallization may be necessary to obtain structural data for this challenging membrane protein.

How can researchers resolve the strain identity issues surrounding Zygnema circumcarinatum and ensure they are working with the correct genetic material?

The confusion regarding Zygnema strain identities, particularly between SAG 698-1a and SAG 698-1b, presents significant challenges for researchers. To ensure working with the correct genetic material, implement this comprehensive verification approach:

  • Multi-marker phylogenetic analysis:

    • Sequence and analyze multiple genetic markers (18S rRNA, rbcL, psaA) from your working strain

    • Construct phylogenetic trees including reference sequences from verified Zygnema species

    • Compare results with published data showing that SAG 698-1a clusters with Z. cylindricum while SAG 698-1b clusters with Z. tunetanum

  • Genome size verification:

    • Perform flow cytometry analysis using the mechanical chopping method to extract nuclei

    • Compare results against known values: approximately 313.2 ± 2.0 Mb for SAG 698-1a vs. 63.5 ± 0.5 Mb for SAG 698-1b

  • Morphological characterization:

    • Examine cell dimensions, mucilage sheath width, and chloroplast morphology

    • Compare against published descriptions for each strain

  • Mating compatibility tests:

    • Attempt conjugation experiments under appropriate conditions

    • Note that true Z. circumcarinatum strains should be able to conjugate if they are complementary mating types

  • Chloroplast genome comparison:

    • Target key diagnostic genes like cysT, which is present in some strains but absent in others

    • Compare sequence identity with published chloroplast genomes

These combined approaches will provide multiple lines of evidence to confirm strain identity and ensure that the genetic material being studied corresponds to the intended organism.

What are the mechanisms of sulfate transport through the CysT/CysW channel complex, and how can they be experimentally investigated?

The molecular mechanisms of sulfate transport through the CysT/CysW channel complex remain incompletely understood, particularly in algal systems. Advanced experimental approaches to investigate these mechanisms include:

  • Structural biology approaches:

    • Cryo-electron microscopy of the assembled CysT/CysW/CysA complex to determine the three-dimensional structure

    • X-ray crystallography of individual components or subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes during transport

  • Site-directed mutagenesis studies:

    • Systematic mutation of conserved amino acids in transmembrane domains

    • Creation of cysteine-scanning mutants for accessibility studies

    • Introduction of reporter residues at potential substrate interaction sites

  • Biophysical characterization of transport:

    • Reconstitution of purified components into liposomes for transport assays

    • Isothermal titration calorimetry to measure binding affinities for sulfate

    • Use of radioactive sulfate (35S) to track transport kinetics

  • Computational approaches:

    • Molecular dynamics simulations of the channel complex in a lipid bilayer

    • Quantum mechanical calculations to model the energetics of sulfate passage

    • In silico docking studies to identify potential binding sites

  • Interaction studies:

    • Co-immunoprecipitation or pull-down assays to confirm protein-protein interactions

    • FRET or BiFC experiments to visualize component assembly in vivo

    • Cross-linking followed by mass spectrometry to map interaction interfaces

Based on studies in bacterial systems like Synechococcus, we know that CysT mutant strains cannot transport sulfate and cannot grow on media with sulfate as the sole sulfur source . This suggests that CysT plays an essential role in forming the channel through which sulfate passes, likely working in conjunction with CysW to create a functional transport pathway.

How do Zygnema strains with different genome sizes (SAG 698-1a vs. SAG 698-1b) compare in terms of their sulfate transport systems and cysT expression?

The dramatic difference in genome size between SAG 698-1a (313.2 ± 2.0 Mb) and SAG 698-1b (63.5 ± 0.5 Mb) raises fascinating questions about the evolution and function of their sulfate transport systems :

  • Genomic organization differences:

    • In SAG 698-1a (now thought to be Z. cylindricum or closely related), the cysT gene is located in the chloroplast genome along with cysA

    • The organization in SAG 698-1b is less well-characterized but may differ significantly given the evolutionary distance between these strains

  • Gene copy number and paralogs:

    • The larger genome of SAG 698-1a might contain additional nuclear-encoded sulfate transporters or regulatory components

    • Comparative genomic analyses should investigate whether the five-fold difference in genome size correlates with expansion of specific gene families

  • Expression patterns and regulation:

    • RNA-seq studies comparing the two strains under identical sulfur limitation conditions would reveal differences in expression regulation

    • Preliminary physiological data shows different adaptation strategies to environmental stresses between the strains, which may extend to sulfur metabolism

  • Functional efficiency:

    • Transport kinetics studies (Km and Vmax determinations) could reveal whether the sulfate uptake systems in these different strains have evolved different affinities or capacities

    • Similar to observations in Scenedesmus acutus strains, the two Zygnema strains might employ different strategies for sulfate uptake, with one favoring high-affinity transporters and the other low-affinity systems

This comparison offers a unique opportunity to study how genome size evolution affects metabolic systems like sulfate transport, potentially revealing adaptations to different ecological niches.

How can the cysT gene be utilized as a selection marker in chloroplast transformation systems for Zygnema or other algae?

The cysT gene offers potential as a selection marker for chloroplast transformation systems based on its essential role in sulfate transport. Implementation strategies include:

  • Complementation-based selection system:

    • Generate a cysT knockout strain that requires reduced sulfur compounds (like cysteine or methionine) for growth

    • Design transformation vectors carrying a functional cysT gene along with the gene of interest

    • Select transformants on media containing only sulfate as the sulfur source, where only cells with successful chloroplast transformation can grow

  • Optimization considerations:

    • Ensure the promoter and regulatory elements are appropriate for the host species

    • Include flanking homologous sequences for targeted recombination

    • Optimize codon usage if transferring between evolutionarily distant species

  • Advantages over existing markers:

    • Metabolic selection rather than antibiotic resistance, avoiding environmental concerns

    • Potentially higher transformation efficiency due to strong selective pressure

    • Reversible selection system that can be toggled by changing media composition

  • Potential applications:

    • Production of recombinant proteins in the chloroplast

    • Investigation of chloroplast gene function

    • Engineering of sulfur metabolism pathways

This approach is particularly promising for Zygnematophyceae as models for understanding early land plant evolution, given their position as closest algal relatives to land plants .

What insights does the study of cysT in Zygnema provide about the evolution of sulfate transport systems during the transition from aquatic algae to land plants?

The study of cysT in Zygnema provides valuable evolutionary insights, as Zygnematophyceae are the closest living algal relatives to land plants :

  • Evolutionary trajectory:

    • The location of cysT in the chloroplast genome of Zygnema represents an ancestral state, while most land plants have nuclear-encoded sulfate transporters

    • This suggests gene transfer from chloroplast to nucleus occurred during land plant evolution

    • Comparative analysis of Zygnema with land plants can pinpoint when and how this transfer occurred

  • Functional adaptations:

    • Zygnema species (particularly SAG 698-1a) show remarkable stress resilience and can grow in extreme habitats like the Arctic

    • The sulfate transport system may have evolved specialized features to function under these conditions

    • These adaptations might represent intermediate steps in the evolution of land plant sulfate transport systems

  • Regulatory evolution:

    • Changes in regulation of sulfate transporters likely accompanied the transition to land

    • Comparison of cysT regulation in Zygnema with that of homologous genes in land plants can reveal how regulatory networks evolved

  • Structural implications:

    • Gene clustering patterns around cysT in the Zygnema chloroplast genome differ from those in Staurastrum and other algae

    • These differences reflect evolutionary events like gene rearrangements, losses, and duplications that shaped early land plant evolution

The presence of cysT in Zygnema but its absence in related algae like Staurastrum indicates dynamic evolution of sulfate transport systems within streptophyte algae, providing clues about adaptations that preceded and facilitated the colonization of land.

How might engineered variants of Zygnema cysT be used to enhance sulfur utilization efficiency in photosynthetic organisms?

Engineered variants of Zygnema cysT could potentially enhance sulfur utilization efficiency in photosynthetic organisms through several strategic approaches:

  • Affinity engineering:

    • Modify key residues in the substrate-binding regions to increase affinity for sulfate

    • Create variants with altered kinetic properties (lower Km or higher Vmax) through directed evolution

    • Design chimeric transporters combining high-efficiency domains from different sources

  • Regulatory modifications:

    • Decouple expression from native regulatory mechanisms to maintain high expression regardless of sulfur status

    • Engineer promoter regions for constitutive expression or response to alternative signals

    • Create variants resistant to post-translational downregulation

  • Substrate range expansion:

    • Modify the channel properties to efficiently transport alternative sulfur compounds (thiosulfate, sulfite)

    • Engineer versions that can utilize previously inaccessible sulfur sources in soil or water

    • Create dual-function transporters that can simultaneously transport sulfate and other beneficial ions

  • Environmental adaptation:

    • Develop variants with enhanced function under specific stress conditions (drought, salinity, cold)

    • Engineer transporters that maintain activity at broader pH ranges

    • Create thermostable variants for hot environments

  • Applications in various systems:

    • Crop plants: Improve sulfur acquisition in low-sulfur soils

    • Algal biofuels: Enhance sulfur uptake efficiency to maximize biomass production

    • Phytoremediation: Increase capacity to accumulate sulfur-containing pollutants

The unique properties of CysT from extremophilic Zygnema species that can thrive in harsh Arctic conditions make it a particularly promising candidate for engineering sulfate transporters with enhanced environmental resilience.

What are the major obstacles in purifying functional recombinant CysT protein, and how can they be overcome?

Purifying functional membrane proteins like CysT presents several significant challenges. Here are the major obstacles and methodological solutions:

  • Membrane protein solubilization challenges:

    • Problem: CysT, with its multiple transmembrane domains, is highly hydrophobic and difficult to extract from membranes while maintaining its native conformation.

    • Solution: Implement a systematic detergent screening approach using a panel of mild detergents (DDM, LMNG, GDN) at varying concentrations and pH conditions. Alternative solubilization technologies like SMALPs (styrene-maleic acid lipid particles) can extract membrane proteins with their native lipid environment intact.

  • Low expression yields:

    • Problem: Membrane proteins often show toxicity to expression hosts when overproduced.

    • Solution: Utilize specialized expression strains (C41/C43 for E. coli), regulate expression levels using tunable promoters, and consider fusion partners that enhance folding and stability (SUMO, MBP). Explore alternative expression systems like cell-free protein synthesis that can produce membrane proteins without cellular toxicity constraints.

  • Protein instability during purification:

    • Problem: CysT may rapidly denature once removed from the membrane environment.

    • Solution: Maintain a stable lipid-like environment throughout purification by including appropriate lipids in purification buffers. Consider nanodiscs, amphipols, or other membrane mimetics for long-term stability. Perform all purification steps at 4°C with protease inhibitors to minimize degradation.

  • Functional assessment difficulties:

    • Problem: Confirming that purified CysT retains its native transport activity is challenging.

    • Solution: Develop robust functional assays such as reconstitution into proteoliposomes followed by radioactive (35S-labeled) sulfate uptake measurements or fluorescence-based transport assays using sulfate-sensitive fluorescent indicators.

  • Protein heterogeneity:

    • Problem: Purified membrane proteins often exist in multiple conformational states or oligomeric forms.

    • Solution: Employ analytical techniques like size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess sample homogeneity. Use GFP-fusion approaches to monitor protein folding and stability throughout the purification process.

By addressing these challenges systematically, researchers can obtain sufficient quantities of functional CysT protein for structural studies and biochemical characterization.

How can researchers effectively study CysT function in the context of the complete sulfate transport system?

Studying CysT function within the complete sulfate transport system requires integrated approaches that preserve the complex interactions between components:

  • Reconstitution of the complete transport system:

    • Co-express all components (CysT, CysW, CysA, and SbpA) with appropriate tags for co-purification

    • Reconstitute the purified complex into liposomes or nanodiscs for functional studies

    • Use defined lipid compositions that mimic the native membrane environment

  • In vivo assay systems:

    • Develop fluorescent reporter strains where intracellular sulfate levels can be monitored in real-time

    • Create conditional mutants where individual components can be selectively inactivated

    • Implement CRISPR-Cas9 genome editing to introduce specific mutations in cysT while maintaining the intact transport system

  • Component interaction studies:

    • Apply crosslinking mass spectrometry (XL-MS) to map interaction interfaces between CysT and other components

    • Use förster resonance energy transfer (FRET) with fluorescently labeled components to monitor dynamic interactions

    • Perform bacterial or yeast two-hybrid screens to identify novel interaction partners

  • Systems biology approaches:

    • Combine transcriptomics, proteomics, and metabolomics to understand how perturbations in CysT affect the entire sulfur assimilation pathway

    • Construct computational models of the complete transport process integrating structural and kinetic data

    • Apply flux analysis using stable isotope labeling to track sulfate movement through the system

  • Comparative studies across species:

    • Analyze how the CysT-containing transport system differs between Zygnema and other photosynthetic organisms

    • Investigate how variations in one component affect the function of others across evolutionary diverse systems

    • Perform complementation studies using heterologous components to identify functionally conserved domains

These approaches provide a comprehensive understanding of CysT's role within the larger biological context of sulfate transport and metabolism.

What are the best experimental designs to resolve contradictory findings about cysT function and localization in different Zygnema strains?

To resolve contradictory findings about cysT function and localization in different Zygnema strains, researchers should implement rigorous experimental designs with appropriate controls:

  • Definitive strain identification and authentication:

    • Establish a reference panel of authenticated Zygnema strains with verified molecular markers

    • Perform whole genome or chloroplast genome sequencing on working strains to confirm identity

    • Document detailed morphological characteristics alongside molecular data

    • Deposit verified strains in multiple culture collections with clear documentation

  • Multi-method localization studies:

    • Combine in situ hybridization for cysT mRNA with immunolocalization of the CysT protein

    • Develop fluorescent protein fusions for live-cell tracking of CysT

    • Use subcellular fractionation followed by Western blotting to quantitatively assess distribution

    • Apply chloroplast isolation protocols to definitively determine if CysT localizes to this organelle

  • Functional complementation experiments:

    • Generate cysT knockout mutants in model systems (when possible)

    • Test if cysT genes from different Zygnema strains can functionally complement these mutants

    • Measure sulfate uptake kinetics in complemented strains to quantify functional differences

    • Create chimeric proteins to map functional domains responsible for observed differences

  • Controlled environmental response studies:

    • Expose authenticated strains to identical sulfur limitation conditions

    • Monitor cysT expression using RT-qPCR with carefully validated reference genes

    • Measure physiological parameters (growth, photosynthetic efficiency) in parallel

    • Analyze sulfate uptake rates under controlled conditions across strains

  • Blind testing and replication:

    • Implement blind experimental designs where strain identity is masked during analysis

    • Perform key experiments in multiple independent laboratories

    • Establish standardized growth and experimental conditions

    • Use statistical power analyses to ensure adequate sample sizes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.