Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
RCF1; AIM31; ZYRO0D13684g; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Target Names
RCF1
Target Protein Sequence
MSGLPSSFDSKEASVDELPFLEKVKFHCKQQPLVPLGTLLTTGAVALAAQNVRTGNKKKA QVWFRWRVGLQAATLVALVAGSFIYGSSLKEKKSEEEKMREKAKMRELLWIQELERRDQE TQYRRKRAELARQKMQENEAAVSRLQKELKDLESHIKNEK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

  • What methodologies are most effective for studying AIM31's role in mitochondrial inheritance?

    To investigate AIM31's role in mitochondrial inheritance, researchers can employ several complementary approaches:

    1. Gene deletion/knockout studies: Utilizing the Cre-loxP system to create AIM31 knockout strains in Z. rouxii. This approach involves replacing the AIM31 gene with a loxP-kanMX-loxP cassette, followed by rescue of the marker using Cre recombinase expressed from a plasmid like pGRCRE . The resulting knockout strains can be analyzed for alterations in mitochondrial morphology, inheritance patterns, and stress tolerance.

    2. Fluorescence microscopy: Tagging AIM31 with fluorescent proteins like GFP and simultaneously labeling mitochondria with MitoTracker dyes to track AIM31 localization and movement during cell division.

    3. Protein interaction studies: Applying chemical cross-linking mass spectrometry (XL-MS) similar to that used for studying SS-31 interactions . This technique can identify proteins that interact with AIM31, providing insights into its functional network.

    4. Comparative genomics: Analyzing AIM31 homologs across yeast species with different mitochondrial inheritance patterns to identify conserved functional domains.

    5. Mitochondrial segregation assays: Following the distribution of mitochondria containing marked mtDNA in cells with wild-type versus mutated AIM31 to quantify inheritance defects .

    These methodologies should be combined for a comprehensive understanding of AIM31's role in mitochondrial inheritance.

  • How does AIM31 in Z. rouxii compare functionally to its homologs in other yeast species?

    Comparative analysis of AIM31 across yeast species reveals both conservation and functional divergence:

    SpeciesGene IDKey Functional DifferencesStress Response Role
    Z. rouxiiZYRO0D13684gEnhanced hypoxia response domainHigh osmotic/sugar stress tolerance
    S. cerevisiaeAIM31, SCRG_01865Well-characterized role in mitochondrial inheritanceModerate stress tolerance
    C. tropicalisCTRG_03194Contains additional conserved hypothetical domainsPathogenicity-related functions
    P. pastorisPAS_chr1-3_0297Hypothetical protein functionsMethanol metabolism association

    The functional divergence of AIM31 across species likely reflects adaptation to different ecological niches. Z. rouxii AIM31 appears specialized for extreme environments (high sugar/salt), while homologs in other species may prioritize different functions . Research methodologies to explore these differences include:

    • Heterologous expression experiments where AIM31 from different species is expressed in a common host to assess functional complementation

    • Domain-swapping experiments to identify which regions confer specific stress-response capabilities

    • Evolutionary rate analysis to identify positively selected residues that may confer species-specific functions

    These analyses can provide insights into how AIM31 contributes to Z. rouxii's exceptional stress tolerance compared to other yeasts.

  • What techniques are available for manipulating AIM31 expression in Z. rouxii?

    Several genetic tools have been developed for manipulating gene expression in Z. rouxii:

    1. Plasmid-based expression systems: Both centromeric and episomal vectors have been developed for Z. rouxii, including those carrying antibiotic resistance markers (KanMX and ClonNAT) . These vectors can be used for controlled expression of AIM31 under various promoters.

    2. Cre-loxP system: The plasmid pGRCRE enables Cre recombinase-mediated marker recycling during multiple gene deletions or modifications . This system is particularly useful for introducing specific mutations in AIM31 while maintaining the ability to make additional genetic modifications.

    3. Electroporation protocols: Methods for introducing DNA into Z. rouxii have been optimized using electroporation, which has proven more effective than chemical transformation methods for this species .

    4. Promoter systems: The GAL1 and GAL10 promoters have been successfully used in vectors for controlled expression in Z. rouxii, as demonstrated in studies overexpressing FBA and TPI genes .

    5. CRISPR-Cas9 adaptations: Though not explicitly mentioned in the search results, CRISPR systems adapted for non-conventional yeasts are likely applicable to Z. rouxii for precise genome editing.

    When manipulating AIM31 expression, researchers should consider Z. rouxii's tolerance to various stressors and optimize transformation conditions accordingly. For industrial strains that are often prototrophic and allodiploid/aneuploid, dominant drug resistance markers are particularly useful .

  • How can protein interaction networks involving AIM31 be characterized in Z. rouxii?

    Characterizing protein interaction networks involving AIM31 requires multiple complementary approaches:

    1. Chemical cross-linking mass spectrometry (XL-MS): This technique, as demonstrated in the study of SS-31 interactions , can identify direct protein interactions in intact mitochondria. For AIM31, researchers can use biotinylated AIM31 (bAIM31) and PIR cross-linkers applied to isolated mitochondria, followed by affinity enrichment of cross-linked complexes and mass spectrometry analysis.

    2. Computational prediction: Tools like the STRING database can predict potential interactions based on genomic context, co-expression patterns, and homology to known interacting proteins in other species . For AIM31, this approach can identify probable interaction partners involved in mitochondrial functions.

    3. Co-immunoprecipitation (Co-IP): Using antibodies against AIM31 or epitope-tagged versions of AIM31 to pull down interacting proteins from mitochondrial extracts, followed by mass spectrometry identification.

    4. Yeast two-hybrid screening: Though challenging with mitochondrial proteins, modified split-ubiquitin yeast two-hybrid systems can be used to identify potential AIM31 interactors.

    5. Proximity labeling: Techniques like BioID or APEX2, where AIM31 is fused to a proximity-dependent labeling enzyme that biotinylates nearby proteins, allowing their identification after streptavidin pulldown.

    A comprehensive approach would combine multiple methods, as each has strengths and limitations. For instance, XL-MS provides direct evidence of interactions and spatial information but may miss transient interactions, while computational predictions offer broader coverage but require experimental validation.

Advanced Research Questions

  • How might AIM31 contribute to Z. rouxii's exceptional osmotolerance and high-sugar adaptation mechanisms?

    Z. rouxii's ability to survive in extreme high sugar environments likely involves mitochondrial adaptations, potentially including AIM31's functions. Several mechanisms may connect AIM31 to osmotolerance:

    1. Mitochondrial membrane integrity: AIM31 may help maintain mitochondrial membrane structure under osmotic stress. Research has shown that cell wall remodeling enzymes like FKS1, UTR2, and CHS1 are differentially regulated in Z. rouxii under high sugar stress (60% w/v) . AIM31 could play a similar protective role for mitochondrial membranes.

    2. Stress signaling pathways: Similar to how Z. rouxii's ZrKAR2 (encoding Hsp70) affects growth at high sugar concentrations , AIM31 may participate in stress response signaling. Experimental approaches could include analyzing AIM31 expression patterns in parallel with known stress-responsive genes under various sugar concentrations.

    3. Energy metabolism adaptation: Z. rouxii shows expanded gene families related to sugar stress, including those involved in "transmembrane transport" . AIM31 might participate in mitochondrial adaptations that support altered energy metabolism under high sugar conditions.

    4. Hypoxia response coordination: Given AIM31's hypoxia-responsive domain, it may help coordinate responses to the limited oxygen availability that often accompanies high-density sugar solutions.

    Testing these hypotheses would require creating AIM31 knockout or overexpression strains and assessing their growth, metabolic profiles, and mitochondrial function under various sugar concentrations. Transcriptomic and proteomic analyses comparing wild-type and AIM31-modified strains could reveal associated pathways.

  • What are the methodological challenges in studying AIM31's role in mitochondrial inheritance patterns?

    Investigating AIM31's role in mitochondrial inheritance faces several methodological challenges:

    1. Genetic manipulation difficulties: Z. rouxii has been described as recalcitrant to conventional transformation procedures . Researchers must optimize transformation protocols, potentially using the recently developed vectors with dominant drug resistance markers (KanMX and ClonNAT) .

    2. Complex ploidy and hybrid nature: Many industrial Z. rouxii strains are prototrophic and allodiploid/aneuploid , complicating genetic studies due to potential gene redundancy. Complete deletion of AIM31 may require targeting multiple alleles, demanding sophisticated approaches like sequential marker recycling with the Cre-loxP system.

    3. Mitochondrial visualization challenges: Tracking mitochondrial inheritance requires reliable labeling techniques. While fluorescent proteins and dyes are options, Z. rouxii's thick cell wall may hinder dye penetration, necessitating optimization of staining protocols.

    4. Cell cycle synchronization: Studying inheritance patterns ideally requires synchronized cell populations. Methods effective in S. cerevisiae may need adaptation for Z. rouxii.

    5. Distinguishing direct vs. indirect effects: Changes in mitochondrial inheritance upon AIM31 modification could result from direct effects on inheritance machinery or indirect effects via altered mitochondrial function. Combined approaches including protein interaction studies, localization experiments, and phenotypic analyses are necessary to distinguish these possibilities.

    Researchers can address these challenges by employing multi-faceted approaches and adapting methods from studies of mitochondrial inheritance in other yeast species, while accounting for Z. rouxii's unique characteristics.

  • How can structural biology approaches be applied to understand AIM31 function in extreme environments?

    Structural biology provides valuable insights into how AIM31 functions in extreme environments:

    1. X-ray crystallography and cryo-EM: Determining the three-dimensional structure of purified recombinant Z. rouxii AIM31 can reveal functional domains and potential interaction surfaces. Comparisons with homologs from less stress-tolerant species may highlight structural adaptations unique to Z. rouxii.

    2. Solution NMR studies: For examining AIM31's structural dynamics in various conditions mimicking osmotic stress. This approach can reveal conformational changes that occur under different salt or sugar concentrations.

    3. Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map structural flexibility and solvent accessibility changes in AIM31 under different stress conditions, identifying regions that undergo conformational changes during stress adaptation.

    4. Molecular dynamics simulations: Computational modeling of AIM31 structure in environments mimicking high osmolarity can predict how the protein behaves under stress and identify key residues for function.

    5. Site-directed mutagenesis combined with functional assays: Based on structural insights, targeted mutations can be introduced to test the importance of specific residues for function under extreme conditions.

    For these approaches, expression and purification of recombinant AIM31 to high homogeneity is essential. The use of E. coli, yeast, baculovirus, or mammalian cell expression systems should be optimized to produce protein with native-like properties . Additionally, researchers should consider reconstituting AIM31 in liposomes or nanodiscs containing cardiolipin to better mimic its natural mitochondrial membrane environment.

  • What potential exists for using knowledge about AIM31 function in engineering stress-resistant industrial yeast strains?

    Understanding AIM31's function opens several avenues for engineering stress-resistant yeast strains:

    1. Overexpression strategies: Similar to the successful overexpression of FBA and TPI genes that enhanced HDMF production in Z. rouxii , controlled overexpression of AIM31 could potentially enhance mitochondrial function under stress. Researchers should design expression constructs using strong promoters like GAL1/GAL10 and optimize codon usage for the host organism.

    2. Cross-species functional engineering: Introducing Z. rouxii AIM31 into less stress-tolerant yeasts like S. cerevisiae could transfer aspects of Z. rouxii's resilience. This approach has been demonstrated with other genes, such as the successful transfer of Z. rouxii OLE1 and FAD2 genes to S. cerevisiae, which increased unsaturated fatty acid content and stress tolerance .

    3. Synthetic biology approaches: Creating chimeric proteins combining the most stress-resistant domains of AIM31 from various species could produce enhanced stress tolerance. This requires detailed knowledge of domain functions obtained through the structural studies described earlier.

    4. Multi-gene engineering strategies: Combining AIM31 modifications with other stress-responsive genes in a coordinated expression system could have synergistic effects. For example, co-expression with genes involved in cell wall remodeling (like FKS1, UTR2) or stress response (like ZrKAR2) that are known to respond to sugar stress in Z. rouxii .

    5. Promoter engineering: Developing synthetic promoters that fine-tune AIM31 expression in response to specific stressors could allow for dynamic adaptation to changing environmental conditions.

    These approaches should be tested using appropriate stress tolerance assays, measuring parameters such as growth rates under various stress conditions, mitochondrial function, membrane integrity, and production of industrially relevant compounds. Long-term genetic stability must also be assessed, as demonstrated in studies of engineered strains like F10-D, T17-D, and TF15-A that maintained stability while showing enhanced production capabilities .

Techniques and Methodologies

  • What are the optimal conditions for expressing and purifying recombinant Z. rouxii AIM31?

    Optimal conditions for expressing and purifying recombinant Z. rouxii AIM31 include:

    Expression systems and conditions:

    Expression SystemVectorInduction ConditionsExpected Yield
    E. coli BL21(DE3)pET-basedIPTG (0.1-0.5 mM), 16-20°C overnightModerate to high
    Pichia pastorispPICZMethanol induction, 28-30°C, 72-96 hrsHigh
    Saccharomyces cerevisiaepESCGalactose induction, 30°C, 24-48 hrsModerate
    Baculovirus/insect cellspFastBacInfection at MOI 1-5, 27°C, 72 hrsVariable

    Purification protocol:

    1. Cell lysis: For yeast systems, mechanical disruption with glass beads or high-pressure homogenization in buffer containing protease inhibitors is recommended. For E. coli, sonication or French press in similar buffers is effective.

    2. Initial purification: Affinity chromatography using His-tag, GST-tag, or other fusion tags depending on the construct design. For His-tagged AIM31, use IMAC with Ni-NTA resin and imidazole gradient elution.

    3. Secondary purification: Size exclusion chromatography to remove aggregates and achieve >95% purity for structural studies.

    4. Buffer optimization: AIM31 shows stability in Tris-based buffers with 50% glycerol . For functional studies, buffers mimicking mitochondrial environment may be preferred.

    5. Storage conditions: Store at -20°C for extended periods, with working aliquots at 4°C for up to one week. Repeated freeze-thaw cycles should be avoided .

    Quality control:
    SDS-PAGE analysis should confirm ≥85% purity, with additional Western blot analysis to verify identity. Functional assays relevant to mitochondrial membrane association can further validate the properly folded state of the purified protein.

  • What genome editing strategies are most effective for AIM31 functional studies in Z. rouxii?

    Effective genome editing strategies for AIM31 functional studies in Z. rouxii include:

    1. Homologous recombination with selectable markers: The most established method uses homologous recombination to replace the ZYRO0D13684g gene with a deletion cassette containing a selectable marker. Dominant drug resistance markers like KanMX (G418 resistance) and ClonNAT are particularly useful for prototrophic industrial strains .

    2. Cre-loxP system for marker recycling: The pGRCRE plasmid enables Cre recombinase-mediated marker recycling, allowing sequential genetic modifications . This is valuable for:

      • Creating clean deletions without marker sequences

      • Introducing point mutations to study specific protein domains

      • Making multiple modifications in the same strain

    3. Conditional expression systems: For essential genes, conditional expression using regulatable promoters (like GAL1/GAL10) allows studying AIM31 function by turning expression on or off .

    4. Site-directed mutagenesis: For studying specific residues or domains, precise mutations can be introduced using two-step recombination approaches:

      • First, replace AIM31 with a selectable marker

      • Then, transform with a mutated version and select for marker loss

    5. Electroporation optimization: Transformation efficiency in Z. rouxii is typically improved using electroporation rather than chemical methods . Optimized parameters include:

      • Cell density: OD600 of 1.5-2.0

      • Field strength: 1.5 kV/cm

      • DNA concentration: 1-5 μg of linearized DNA

    For validating genomic modifications, multiple screening approaches should be employed, including PCR verification with primers flanking the targeted region, sequencing to confirm precise editing, and qRT-PCR to verify expression changes .

  • How can evolutionary analysis of AIM31 inform our understanding of its functional adaptation in Z. rouxii?

    Evolutionary analysis of AIM31 can provide significant insights into its functional adaptation:

    1. Comparative genomics approach: Analyze AIM31 sequences across yeast species with varying stress tolerances to identify:

      • Conserved regions likely essential for core mitochondrial functions

      • Variable regions that correlate with species-specific stress tolerance

      • Positive selection signatures in lineages adapted to extreme environments

    2. Phylogenetic analysis methodology:

      • Collect AIM31 homologs from diverse yeast species

      • Perform multiple sequence alignment using MUSCLE or MAFFT

      • Construct phylogenetic trees using maximum likelihood or Bayesian methods

      • Map ecological niches and stress tolerance phenotypes onto the tree

      • Calculate dN/dS ratios to identify sites under positive selection

    3. Gene duplication and neofunctionalization analysis:

      • Investigate whether AIM31 has undergone duplication events in Z. rouxii

      • Examine expression patterns of paralogs under different conditions

      • This is particularly relevant given Z. rouxii's expanded gene families related to sugar stress

    4. Domain architecture evolution:

      • Analyze how the hypoxia-responsive domain and other functional regions have evolved

      • Compare with homologs in species lacking extreme osmotolerance

    5. Horizontal gene transfer investigation:

      • Assess whether any components of AIM31 or its regulatory elements show evidence of horizontal acquisition

    These evolutionary analyses can guide functional studies by identifying key residues and domains likely responsible for Z. rouxii's exceptional stress tolerance. Researchers can then focus experimental efforts on these regions through targeted mutagenesis and functional assays. Additionally, evolutionary insights can inform synthetic biology approaches by suggesting how to combine beneficial features from multiple species into optimized versions of AIM31 for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.