Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)
Description
Introduction to Zygosaccharomyces rouxii AIM36
Zygosaccharomyces rouxii is an osmotolerant yeast known for its ability to survive in high-sugar environments, a trait that influences its role in fermentation and its capacity to spoil food products . Altered Inheritance of Mitochondria (AIM) proteins, including AIM36, are crucial for mitochondrial function and inheritance . AIM36, also known as Found in Mitochondria Protein 39 (FMP39), is a protein found in Zygosaccharomyces rouxii mitochondria . Recombinant AIM36 is produced in E. coli and may be used in research applications .
Gene Information and Characteristics
AIM36 is encoded by the gene AIM36 (ZYRO0A07700g), with synonyms including FMP39 . The protein has the UniProt ID C5DQ08 . The recombinant form of the protein, expressed in E. coli, includes a His tag for purification purposes . The full-length recombinant Zygosaccharomyces rouxii AIM36 protein consists of amino acids 36-238 .
Table 1: Recombinant AIM36 Protein Details
| Feature | Description |
|---|---|
| Species | Zygosaccharomyces rouxii |
| Source | E. coli |
| Tag | His tag (N-terminal) |
| Protein Length | Full Length of Mature Protein (36-238aa) |
| AA Sequence | ASKPAKPAARNNTGPGFAMIFALAIIGTVIFNETAKNLDKNKPRNTFTEEEYEHVMQGLK RRVAMFPDGQLDVQFSLQKDSTQLKKLLGDSKLYIDPGQVVENYRSDREDPYEPLLNEVY SKYGPEYLKYLPQGLLVSLLGRYMKAHCRQGDHVVILDFPHSIKDAIKFENEVSSASKLL VPKESLDSDVCKYYQTVQKSQQL |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Gene Name | AIM36 |
| Synonyms | AIM36; FMP39; ZYRO0A07700g; Altered inheritance of mitochondria protein 36, mitochondrial; Found in mitochondria protein 39 |
| UniProt ID | C5DQ08 |
Production and Quality Control
Recombinant AIM36 is produced in E. coli and purified to greater than 90% purity, as determined by SDS-PAGE . It is often expressed with an N-terminal His tag to facilitate purification using affinity chromatography .
Sugar Adaptation
Zygosaccharomyces rouxii adapts to high sugar environments through differential gene expression . Key processes include glucan synthesis, transmembrane transport, and ribosome activity, which differ significantly from those in Saccharomyces cerevisiae, a less tolerant yeast . For example, genes like FKS3 and KRE9, which are involved in cell wall remodeling, show different expression patterns in Z. rouxii compared to S. cerevisiae under sugar stress .
Table 2: Differentially Expressed Genes (DEGs) in Z. rouxii under High Sugar Stress
| Gene Category | Example Genes | Expression Pattern |
|---|---|---|
| Glucan Biosynthesis | FKS3 (ZYRO0D06974g), KRE9 (ZYRO0G18898g) | Upregulated after 4 hours of sugar stress |
| Transmembrane Transport | TPO1 (ZYRO0F02090g), ZRC1, ITR2, PHO84, SSU1, AGP3, ATP16, YHC3 | TPO1 extensively upregulated (24.8-fold) after 4 hours of sugar stress |
| Cell Wall Integrity | CHS1 | Upregulated after 4 hours of sugar stress |
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Target Background
KEGG: zro:ZYRO0A07700g
