Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 43, mitochondrial (AIM43)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order; we will prioritize its inclusion.
Synonyms
INA17; ZYRO0F14828g; Inner membrane assembly complex subunit 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-176
Protein Length
Full Length of Mature Protein
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Target Names
INA17
Target Protein Sequence
YCPLKSSQGTDIKSLEDLTKLKSLEGVDPELIRKLINERTIELNVQNELEMLKNLNKQEK MSQEVSLKRFVRPLWVFFLMSSTVYLILHYVWWKLEVVEKEKELQSHVESLEMELDQTLK SQNQNVSSSQNNGNNKTNDKPWYRKWFF
Uniprot No.

Target Background

Function

AIM43 is a component of the mitochondrial inner membrane arm complex (INAC) that plays a crucial role in the biogenesis of the mitochondrial F1F0-ATP synthase. INAC facilitates the assembly of the peripheral stalk and promotes the integration of the catalytic F1-domain with the membrane-embedded F0-domain.

Database Links
Protein Families
INA17 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Zygosaccharomyces rouxii and why is it significant for AIM43 research?

Zygosaccharomyces rouxii is a non-conventional yeast species characterized by several distinctive traits: halotolerance, osmotolerance, petite-negative status, and poor Crabtree positivity . These characteristics, combined with its high fermentative vigor, make Z. rouxii an attractive model organism for industrial and food applications .

Z. rouxii was first isolated by Émile Roux from fermenting fruit juice and described as Saccharomyces rouxii by Léon Boutroux in 1883, before being reclassified into the genus Zygosaccharomyces . Its distinctive adaptive capabilities, particularly its exceptional tolerance to high sugar environments, make it valuable for studying stress response mechanisms that may influence mitochondrial function and inheritance .

For researchers investigating AIM43, Z. rouxii provides an alternative model to Saccharomyces cerevisiae, offering insights into how this protein functions in organisms with different metabolic strategies and environmental adaptations.

What is the function of AIM43 in mitochondrial inheritance?

AIM43 (Altered inheritance of mitochondria protein 43) is a mitochondrial protein that plays a role in ensuring proper mitochondrial inheritance during cell division. While the precise molecular mechanisms remain under investigation, research indicates that AIM43 (also known as FMP14 in some contexts) is involved in:

  • Maintaining mitochondrial genome stability during replication and transmission

  • Potentially interacting with other proteins in the mitochondrial membrane

  • Contributing to the proper segregation of mitochondria during cell division

In some yeast species like Saccharomyces cerevisiae, AIM43 is also called INA17 (Inner membrane assembly complex subunit 17) , suggesting a role in mitochondrial membrane organization and assembly. This protein appears to be conserved across various yeast species, though its specific functions may vary slightly between species like S. cerevisiae and Z. rouxii.

How does mitochondrial inheritance in Z. rouxii compare to other yeasts?

Mitochondrial inheritance patterns in Z. rouxii differ from those observed in well-studied yeasts like Saccharomyces cerevisiae. Key differences include:

FeatureZ. rouxiiS. cerevisiaeOther Yeasts (e.g., Dictyostelium)
Inheritance PatternPrimarily uniparentalPrimarily uniparentalCan exhibit triparental inheritance
Petite PhenotypePetite-negative (cannot form petite colonies) Petite-positiveVaries by species
Response to mtDNA LossLethalCan survive with functional loss of mtDNAVaries by species
Heteroplasmy HandlingLess studied, likely different mechanismsWell-characterized mechanismsCan maintain heteroplasmy in some cases

The petite-negative characteristic of Z. rouxii indicates that functional mitochondria are essential for its survival, making the mechanisms ensuring proper mitochondrial inheritance particularly critical in this organism . This trait makes Z. rouxii a valuable model for studying proteins like AIM43 that are involved in mitochondrial inheritance.

What are the established methods for genetic manipulation of AIM43 in Z. rouxii?

Genetic manipulation of Z. rouxii, including AIM43 modifications, requires specialized approaches due to this yeast's recalcitrance to conventional transformation procedures . Researchers should consider the following methodologies:

  • Vector Selection:

    • For AIM43 studies, both centromeric and episomal vectors with dominant drug resistance markers (KanMX and ClonNAT) have been successfully developed .

    • These vectors are preferred over those with prototrophic markers, as many industrial Z. rouxii strains are prototrophic and allodiploid/aneuploid .

  • Transformation Protocol:

    • LiAc-based transformation methods have been adapted for Z. rouxii .

    • When transforming Z. rouxii with AIM43-related constructs, researchers typically grow cells to late exponential phase in YPD medium before transformation .

  • Gene Deletion Strategy:

    • For AIM43 deletion, the Cre-loxP system using plasmid pGRCRE allows marker recycling during multiple gene deletions .

    • Practical approach: The KanMX gene can be amplified using PCR with primers containing homologous regions to the AIM43 locus. After transformation, selection is performed on YPD plates containing G418 .

  • Verification Methods:

    • Positive colonies should be confirmed by re-sequencing .

    • Growth curve analysis using an automatic growth curve analyzer can verify phenotypic effects of AIM43 manipulation .

A typical experimental workflow is as follows:

  • Design interrupt primers with homology to the AIM43 locus

  • Amplify a selection marker (e.g., KanMX) with these primers

  • Transform Z. rouxii using the LiAc method

  • Select transformants on appropriate selective media

  • Confirm gene replacement by PCR and sequencing

  • Analyze phenotypic effects through growth curves and other functional assays

How can researchers effectively express recombinant AIM43 from Z. rouxii?

Expressing recombinant Z. rouxii AIM43 requires careful consideration of expression systems, purification strategies, and protein stability factors. The following methodological approach is recommended:

  • Expression System Selection:

    • E. coli-based expression systems can be used for initial studies .

    • For studies requiring native post-translational modifications, yeast expression systems (S. cerevisiae or Pichia pastoris) may be preferable.

    • Consider N-terminal tags (such as 10xHis) to facilitate purification while minimizing interference with protein function .

  • Optimization Protocol:

    • Clone the AIM43 coding sequence into an appropriate expression vector.

    • For E. coli expression, optimize codon usage for bacterial expression if necessary.

    • Test multiple expression conditions (temperature, induction time, inducer concentration) to maximize soluble protein yield.

    • For membrane-associated proteins like AIM43, detergent screening may be necessary to maintain solubility.

  • Purification Strategy:

    • Implement affinity chromatography using the N-terminal His-tag.

    • Follow with size exclusion chromatography to ensure purity.

    • Consider storing in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

  • Storage Considerations:

    • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles .

    • For extended storage, lyophilization may extend shelf life to approximately 12 months .

The choice between providing the protein in liquid form or as a lyophilized powder should be based on the specific experimental requirements and stability considerations for downstream applications.

What experimental conditions are optimal for studying Z. rouxii AIM43 function in relation to sugar stress?

Z. rouxii's exceptional tolerance to high sugar environments makes it valuable for studying how proteins like AIM43 function under osmotic stress. Optimal experimental conditions include:

  • Growth Media Formulations:

    • Standard condition: YPD medium with 2% w/v glucose

    • Mild sugar stress: YPD containing 40% w/v glucose

    • Extreme sugar stress: YPD containing 60% w/v glucose

  • Growth Parameters:

    • Temperature: 30°C is optimal for Z. rouxii cultivation

    • Growth phase: Late exponential phase cultures (approximately 2 × 10⁹ CFU/ml) are typically used for stress experiments

    • Exposure time: 4-hour exposure to stress conditions is commonly used for transcriptional studies

  • Analytical Methods:

    • Growth monitoring: Track OD₆₀₀ using spectrophotometry or an automatic growth curve analyzer

    • Gene expression analysis: RNA-seq or qRT-PCR to monitor AIM43 expression levels under different conditions

    • Protein localization: Fluorescence microscopy with tagged AIM43 to observe potential stress-induced changes in localization

  • Control Strains:

    • Include S. cerevisiae under identical conditions for comparative studies

    • Include AIM43 deletion mutants to assess phenotypic effects under stress conditions

Research has shown that Z. rouxii has significantly fewer differentially expressed genes (539) compared to S. cerevisiae (3914) under high sugar stress , suggesting more specific and efficient stress response mechanisms that may involve proteins like AIM43.

How do mutations in AIM43 affect mitochondrial inheritance in yeast models?

Mutations in AIM43 can significantly impact mitochondrial inheritance patterns in yeast models, though the specific effects in Z. rouxii are still being characterized. Based on research in related systems:

  • Inheritance Pattern Alterations:

    • AIM43 mutations may lead to irregular distribution of mitochondria during cell division

    • In some cases, mutations can result in a shift from primarily uniparental to more biparental mitochondrial inheritance patterns

    • The degree of heteroplasmy (mixture of mitochondrial genomes) may increase in AIM43 mutants

  • Phenotypic Consequences:

    • Growth defects, particularly under stress conditions

    • Altered mitochondrial morphology and distribution

    • Changes in respiratory capacity, especially important in petite-negative yeasts like Z. rouxii

  • Molecular Mechanisms:

    • Disruption of protein interactions within the mitochondrial membrane

    • Potential interference with mitochondrial genome replication and segregation

    • Possible effects on mitochondrial fusion and fission dynamics

While specific data for Z. rouxii AIM43 mutants is still emerging, research in S. cerevisiae suggests that proteins involved in mitochondrial inheritance, such as AIM43, are particularly critical in organisms like Z. rouxii that cannot survive without functional mitochondria.

How is heteroplasmy managed in Z. rouxii compared to other organisms, and what role might AIM43 play?

Heteroplasmy management varies significantly across organisms, and Z. rouxii likely employs distinctive mechanisms that may involve AIM43:

  • Heteroplasmy Management Strategies:

    • In mammals, heteroplasmy is managed primarily through a genetic bottleneck during oogenesis

    • In some protists, heteroplasmy can be maintained and even result in triparental inheritance

    • In Z. rouxii, as a petite-negative yeast, heteroplasmy management is likely stringent

  • Potential AIM43 Roles:

    • May function in recognizing and segregating different mitochondrial genomes

    • Could be involved in selective replication or degradation of specific mitochondrial DNA molecules

    • Might interact with nuclear-encoded factors that regulate heteroplasmy

  • Comparative Analysis:

    OrganismHeteroplasmy ManagementPotential AIM43 Involvement
    Z. rouxiiLikely stringent due to petite-negative natureMay be essential for proper segregation
    S. cerevisiaeCan tolerate heteroplasmyInvolved but not essential
    PlasmodiumMaternal inheritance through exclusion mechanisms Unknown, different mechanisms may exist
    TrypanosomaBiparental inheritance of minicircles Unknown, different kinetoplast structure
  • Research Approaches:

    • Heteroplasmy can be artificially induced through mitochondrial transformation

    • Tracking labeled mitochondrial genomes through cell divisions

    • Analyzing the segregation patterns in AIM43 wild-type versus mutant backgrounds

Understanding heteroplasmy management in Z. rouxii is particularly relevant given its industrial applications, where mitochondrial function directly impacts fermentation efficiency and metabolite production.

What is the relationship between AIM43 and other factors involved in mitochondrial inheritance in osmotolerant yeasts?

AIM43 functions within a complex network of proteins and processes that collectively ensure proper mitochondrial inheritance, particularly in osmotolerant yeasts like Z. rouxii:

  • Interaction Network:

    • AIM43 likely interacts with other mitochondrial membrane proteins

    • May form complexes with factors involved in mitochondrial DNA replication and segregation

    • Could interact with cytoskeletal elements that facilitate mitochondrial movement during cell division

  • Osmotic Stress Response Connections:

    • Research indicates that osmotic stress affects mitochondrial function and inheritance

    • Genes involved in "glucan biosynthesis," "transmembrane transport," and "ribosome" function are differentially expressed under sugar stress in Z. rouxii

    • AIM43 may bridge osmotic stress response pathways and mitochondrial inheritance mechanisms

  • Comparative Pathways in Z. rouxii vs. S. cerevisiae:

    • Z. rouxii shows enrichment in specific pathways under stress conditions that differ from S. cerevisiae

    • For example, in Z. rouxii, a higher percentage of genes related to beta-glucan synthesis, transmembrane transport, and ribosome structure are involved in sugar stress response

    • These differences suggest unique mitochondrial inheritance regulation mechanisms in Z. rouxii

  • Gene Expression Analysis:

    • Under extreme sugar stress (60% glucose), Z. rouxii shows fewer but more targeted gene expression changes compared to S. cerevisiae

    • This suggests more efficient adaptation mechanisms that may involve specialized roles for proteins like AIM43

Further research is needed to fully elucidate the specific protein-protein interactions and regulatory mechanisms through which AIM43 contributes to mitochondrial inheritance in the context of osmotic stress response.

How can researchers distinguish between nuclear and mitochondrial effects when studying AIM43 function?

Distinguishing between nuclear and mitochondrial effects is crucial when studying mitochondrial proteins like AIM43. The following methodological approaches are recommended:

  • Genetic Segregation Analysis:

    • Cross strains with different nuclear backgrounds but identical mitochondrial genomes

    • Track inheritance of AIM43 alleles and mitochondrial phenotypes in progeny

    • Use statistical analysis to correlate phenotypes with nuclear versus mitochondrial genotypes

  • Organelle Isolation Techniques:

    • Isolate purified mitochondria to assess direct effects on mitochondrial function

    • Compare protein composition and activity in isolated mitochondria versus whole-cell extracts

    • Use subfractionation to localize AIM43 within the mitochondria (membrane, matrix, etc.)

  • Complementation Studies:

    • Express AIM43 variants with different subcellular targeting signals

    • Test mitochondrial-targeted versus nuclear-targeted versions for functional complementation

    • Use chimeric proteins to identify specific domains responsible for mitochondrial functions

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Identify differential effects on nuclear versus mitochondrial gene expression

    • Apply network analysis to distinguish direct versus indirect effects

  • Specific Experimental Controls:

    • Include rho⁰ strains (lacking mitochondrial DNA) where possible for S. cerevisiae (not viable for Z. rouxii)

    • Use pharmacological inhibitors of mitochondrial function versus nuclear transcription

    • Implement inducible expression systems to track acute versus chronic effects

By systematically implementing these approaches, researchers can build a comprehensive understanding of how AIM43 functions in both nuclear and mitochondrial contexts, allowing for more precise interpretation of experimental results.

What are the key considerations for interpreting contradictory findings about AIM43 function across different yeast species?

When faced with contradictory findings about AIM43 function across different yeast species, researchers should consider:

  • Evolutionary Context:

    • Z. rouxii and S. cerevisiae diverged evolutionarily and have adapted to different ecological niches

    • Perform phylogenetic analysis of AIM43 sequences to determine conservation versus divergence

    • Consider that similar proteins may have evolved different functions in different species

  • Metabolic Differences:

    • Z. rouxii is osmotolerant, halotolerant, petite-negative, and poorly Crabtree positive

    • S. cerevisiae is less osmotolerant, petite-positive, and strongly Crabtree positive

    • These metabolic differences may result in different roles for the same protein

  • Experimental Conditions:

    • Ensure comparisons are made under equivalent conditions

    • Account for species-specific optimal growth parameters

    • Consider that stress responses may activate different pathways in different species

  • Methodological Variations:

    • Different genetic backgrounds in laboratory strains

    • Various gene manipulation techniques with different efficiencies

    • Potential off-target effects in different genetic systems

  • Data Reconciliation Framework:

    Observation TypeInterpretation ApproachExample
    Consistent phenotypes, different mechanismsLook for convergent evolutionSimilar growth defects through different pathways
    Different phenotypes, similar mechanismsConsider contextual factorsDifferent stress responses despite similar protein interactions
    Contradictory gene expressionAnalyze regulatory networksAIM43 upregulation in one species but downregulation in another
    Inconsistent localizationExamine protein targeting signalsDifferent mitochondrial subcompartment localization

By applying these considerations systematically, researchers can develop more nuanced interpretations of seemingly contradictory data and identify which aspects of AIM43 function are conserved versus species-specific.

How should researchers approach the analysis of AIM43's role in the context of Z. rouxii's unique stress response pathways?

Analyzing AIM43's role in Z. rouxii's unique stress response pathways requires an integrated approach that accounts for this yeast's distinctive biology:

  • Differential Expression Analysis:

    • Compare AIM43 expression under normal versus stress conditions

    • RNA-seq analysis reveals that Z. rouxii has significantly fewer differentially expressed genes (539) compared to S. cerevisiae (3914) under high sugar stress

    • Determine if AIM43 belongs to the core set of genes that respond to osmotic stress

  • Pathway Integration:

    • Map AIM43 to known stress response pathways in Z. rouxii

    • Investigate connections to enriched pathways like "glucan biosynthesis," "transmembrane transport," and "ribosome" function

    • Use clustering analysis to identify genes with similar expression patterns to AIM43 under stress

  • Functional Assays Under Stress:

    • Compare growth curves of wild-type versus AIM43 mutants under different sugar concentrations

    • Assess mitochondrial function parameters (membrane potential, respiration rate, ATP production) under stress

    • Evaluate changes in mitochondrial morphology and inheritance during adaptation to stress

  • Comparative Systems Biology Approach:

    • Implement network analysis to identify AIM43 interaction partners

    • Use metabolic flux analysis to determine how AIM43 affects carbon metabolism under stress

    • Develop predictive models that account for Z. rouxii's unique metabolic capabilities

  • Key Experimental Design Elements:

    • Include appropriate time points (early response versus adaptation)

    • Test multiple stress conditions (40% glucose for mild stress, 60% glucose for extreme stress)

    • Compare responses in different genetic backgrounds to identify strain-specific effects

This comprehensive approach will help researchers disentangle the specific contributions of AIM43 to Z. rouxii's remarkable stress tolerance, potentially revealing novel functions not observed in conventional model yeasts.

What emerging technologies might advance our understanding of AIM43 function in Z. rouxii?

Several cutting-edge technologies show promise for elucidating AIM43 function in Z. rouxii:

  • CRISPR-Cas9 Genome Editing:

    • Development of optimized CRISPR systems for efficient editing in Z. rouxii

    • Creation of conditional AIM43 mutants using inducible promoters

    • Implementation of base editing for precise modification of AIM43 regulatory elements

  • Single-Cell Omics:

    • Single-cell RNA-seq to capture cell-to-cell variation in AIM43 expression

    • Single-cell proteomics to track AIM43 protein levels and modifications

    • Integration of transcriptomic and proteomic data at single-cell resolution

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize AIM43 localization with nanometer precision

    • Live-cell imaging to track mitochondrial dynamics in real-time

    • Correlative light and electron microscopy to link AIM43 localization with ultrastructural features

  • Proximity Labeling Proteomics:

    • BioID or APEX2 tagging of AIM43 to identify proximal interacting proteins in the native context

    • Temporal analysis of the AIM43 interactome under different stress conditions

    • Cross-species comparison of AIM43 interaction networks

  • Systems Biology Integration:

    • Multi-omics data integration (genomics, transcriptomics, proteomics, metabolomics)

    • Machine learning approaches to predict AIM43 functions from complex datasets

    • Development of computational models of mitochondrial inheritance incorporating AIM43

These technologies, applied in combination, have the potential to provide unprecedented insights into how AIM43 contributes to mitochondrial inheritance and stress adaptation in Z. rouxii.

How can findings about Z. rouxii AIM43 contribute to broader understanding of mitochondrial inheritance mechanisms?

Research on Z. rouxii AIM43 has significant potential to expand our understanding of mitochondrial inheritance across species:

  • Evolutionary Insights:

    • Z. rouxii occupies an evolutionary position that can inform the diversification of mitochondrial inheritance mechanisms

    • Comparative studies between Z. rouxii, S. cerevisiae, and other yeasts can reveal conserved versus specialized functions

    • Identification of fundamental principles versus adaptations to specific ecological niches

  • Novel Mechanisms Discovery:

    • Z. rouxii's halotolerance and osmotolerance may have selected for unique mitochondrial inheritance mechanisms

    • AIM43 studies in Z. rouxii might reveal previously unknown functions applicable to other organisms

    • The petite-negative nature of Z. rouxii provides insights into essential aspects of mitochondrial inheritance

  • Translational Applications:

    • Findings may inform strategies for manipulating mitochondrial inheritance in other organisms

    • Potential applications in mitochondrial disease research

    • Insights for metabolic engineering of industrial yeasts for improved fermentation

  • Methodological Advances:

    • Development of new tools for studying mitochondrial inheritance in non-conventional yeasts

    • Refinement of approaches for distinguishing nuclear versus mitochondrial effects

    • Establishment of Z. rouxii as a complementary model to S. cerevisiae for mitochondrial research

  • Conceptual Framework Development:

    • Integration of Z. rouxii findings into broader theories of mitochondrial evolution and inheritance

    • Re-evaluation of current models based on insights from extremophile yeasts

    • Potential paradigm shifts in understanding the relationship between environmental adaptation and organellar inheritance

By positioning Z. rouxii AIM43 research within this broader context, investigators can maximize the impact of their findings beyond the specific organism and contribute to fundamental advances in cell biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.