Recombinant Zygosaccharomyces rouxii Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GET1; ZYRO0G09944g; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Target Names
GET1
Target Protein Sequence
MDSGGWIVYCCIFFILLGKVLEYTSSYQDKWFTKLTLTPEARKLNSQYHELLSERLRLQE ENHSISAQDNYARWTKNNRKLGELDKKLGTIRDKLQETNTSSKKVFGRVKLIGLTIPFWI LKIWQRSHVVYHFPKQDLFPKLVTGVWARGWLYLALGPLQYLRNGSLNIQDYAPHGVSLG IWIWALQATINTLEFLVKQVILEKPVSPPPQKSKSATKAETKRPEKLEITDDKVELD
Uniprot No.

Target Background

Function

Function: Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3. GET3 recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of ER-resident proteins (containing a C-terminal H-D-E-L retention signal) from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Zygosaccharomyces rouxii GET1 protein and what is its function?

Recombinant Zygosaccharomyces rouxii Golgi to ER traffic protein 1 (GET1) is a full-length protein comprising 237 amino acids that plays a critical role in the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. The protein functions as part of the GET complex, where it serves as a membrane receptor component in conjunction with GET2. Together, these proteins interact with soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Additionally, the GET complex cooperates with the HDEL receptor ERD2 to facilitate ATP-dependent retrieval of resident ER proteins containing a C-terminal H-D-E-L retention signal from the Golgi back to the ER .

The recombinant form commonly used in research is expressed in E. coli with an N-terminal His-tag to facilitate purification and experimental manipulation . This protein is also known as "Guided entry of tail-anchored proteins 1," reflecting its functional role in cellular protein trafficking pathways.

How should I design experiments to study GET1 protein interactions?

When designing experiments to study GET1 protein interactions, researchers should implement a systematic approach following established experimental design principles:

  • Define clear research questions and hypotheses: Formulate specific hypotheses about GET1 interactions with other components of the GET complex (particularly GET2 and GET3) or with tail-anchored proteins .

  • Identify independent and dependent variables: For example, the independent variable might be different mutations in GET1, while the dependent variable could be binding affinity to GET3 or effects on TA protein insertion .

  • Control for extraneous variables: Consider factors that might affect protein-protein interactions, such as buffer conditions, temperature, and the presence of contaminants .

A recommended experimental design would include:

  • In vitro binding assays: Using purified components to assess direct interactions between GET1 and potential binding partners

  • Co-immunoprecipitation: To identify protein complexes containing GET1 in cellular contexts

  • FRET or BiFC: To visualize protein interactions in living cells

  • Surface plasmon resonance: For quantitative measurement of binding kinetics

For rigorous validation, implement a true experimental design with appropriate controls rather than relying on observational studies alone . This approach will help establish causality in the observed interactions.

What are the optimal conditions for reconstituting recombinant GET1 protein?

For optimal reconstitution of lyophilized recombinant Zygosaccharomyces rouxii GET1 protein, the following methodological approach is recommended:

  • Initial preparation: Briefly centrifuge the vial containing lyophilized protein to ensure all content is at the bottom before opening .

  • Reconstitution procedure: Dissolve the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • Stabilization: Add glycerol to a final concentration of 5-50% to enhance protein stability. The standard recommendation is 50% glycerol for optimal long-term stability .

  • Storage protocol: After reconstitution:

    • For short-term use (up to one week), store working aliquots at 4°C

    • For long-term storage, prepare small aliquots and store at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Buffer conditions: The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . This buffer composition helps maintain protein stability during the lyophilization process and subsequent reconstitution.

When designing experiments with the reconstituted protein, consider that the His-tag may influence certain protein properties or interactions, potentially necessitating control experiments with tag-cleaved versions of the protein for verification of results.

How can I investigate the role of GET1 in the GET complex machinery?

Investigating the role of GET1 in the GET complex machinery requires a multi-faceted approach that combines genetic, biochemical, and cellular techniques:

  • Structure-function analysis: Generate a series of GET1 mutants targeting specific domains, particularly those involved in interactions with GET2 and GET3. This can be approached through:

    • Alanine scanning mutagenesis of conserved residues

    • Truncation mutants to identify minimal functional domains

    • Chimeric proteins with homologous proteins from other species

  • Reconstitution experiments: Establish an in vitro system using purified components to reconstitute the GET pathway:

    • Express and purify GET1, GET2, and GET3 components

    • Use liposomes to mimic the ER membrane environment

    • Monitor insertion of model tail-anchored proteins in the presence of different GET1 variants

  • Cellular assays: Design experiments to assess GET1 function in vivo:

    • Generate GET1 knockout or knockdown systems using CRISPR-Cas9 or RNAi

    • Perform complementation studies with mutant versions of GET1

    • Monitor localization and stability of known tail-anchored proteins as readouts

  • Interaction mapping: Determine the precise interaction interfaces between GET1 and other components:

    • Implement crosslinking followed by mass spectrometry

    • Perform hydrogen-deuterium exchange experiments

    • Use yeast two-hybrid or mammalian two-hybrid assays with domain fragments

What methods are effective for studying GET1-mediated protein trafficking?

To effectively study GET1-mediated protein trafficking, researchers should implement a combination of cellular, biochemical, and imaging approaches:

  • Cargo protein tracking systems:

    • Develop fluorescently tagged model tail-anchored proteins

    • Monitor their localization in cells with normal, depleted, or mutated GET1

    • Use pulse-chase experiments with photoactivatable fluorescent proteins to track real-time trafficking

  • Biochemical fractionation:

    • Isolate different cellular compartments (cytosol, ER, Golgi)

    • Quantify the distribution of cargo proteins in each fraction

    • Compare trafficking efficiency between wild-type and GET1-deficient cells

  • In vitro transport assays:

    • Reconstitute the GET pathway using purified components

    • Include fluorescently labeled tail-anchored proteins

    • Measure insertion into synthetic liposomes containing reconstituted GET1 and GET2

  • Live-cell imaging:

    • Implement FRAP (Fluorescence Recovery After Photobleaching) to measure dynamics

    • Use super-resolution microscopy to visualize trafficking events at the ER membrane

    • Apply single-particle tracking to follow individual cargo molecules

  • Interaction with the HDEL retrieval pathway:

    • Investigate how GET1 cooperates with the ERD2 receptor

    • Study the ATP-dependent retrieval of ER resident proteins from the Golgi

    • Examine potential regulatory mechanisms governing this cooperation

When designing these experiments, true experimental design principles should be applied, including appropriate controls and randomization where possible to ensure valid results .

How should I interpret contradictory results in GET1 functional studies?

When faced with contradictory results in GET1 functional studies, researchers should implement a systematic approach to identify potential sources of discrepancy and resolve conflicting data:

  • Evaluate experimental design differences:

    • Compare the type of experimental design used in each study (one-shot case study, pretest-posttest, true experimental design)

    • Assess whether differences in experimental rigor might explain contradictory outcomes

    • Consider if selection bias or lack of randomization influenced results

  • Analyze methodological variations:

    • Review protein preparation methods (expression system, purification approach, tag position)

    • Compare buffer conditions, temperature, pH, and salt concentrations

    • Examine differences in reconstitution protocols or storage conditions

  • Assess genetic and species differences:

    • Consider variations between Z. rouxii GET1 and homologs from other species

    • Evaluate whether genetic background differences in experimental systems might contribute to contradictory results

    • Check for potential post-translational modifications affecting function

  • Implement resolution strategies:

    • Perform side-by-side comparisons using standardized conditions

    • Collaborate with labs reporting contradictory results

    • Design experiments that can specifically test competing hypotheses

  • Statistical reassessment:

    • Review statistical approaches used in each study

    • Consider sample sizes and power calculations

    • Evaluate whether appropriate controls were included

Remember that contradictions in scientific results often lead to deeper understanding of complex biological systems. The GET pathway involves multiple proteins working in concert, and apparent contradictions may reflect context-dependent functions or regulatory mechanisms that have not been fully characterized.

What data visualization approaches are appropriate for GET1 interaction studies?

Effective data visualization is critical for communicating GET1 interaction study results. The following approaches are particularly well-suited for different types of GET1 research data:

  • Protein-protein interaction networks:

    • Use node-edge diagrams to represent GET1 and its interaction partners

    • Apply force-directed layouts to visualize the GET complex organization

    • Encode interaction strengths through edge thickness or color

    • Incorporate subcellular localization information through spatial arrangement

  • Binding kinetics visualization:

    • Present surface plasmon resonance data as association/dissociation curves

    • Use heat maps to compare binding parameters across multiple GET1 mutants

    • Implement radar charts to display multidimensional binding properties

  • Structural data representation:

    • Create ribbon diagrams highlighting GET1's transmembrane domains

    • Use surface electrostatic potential maps to identify potential interaction interfaces

    • Develop interactive 3D models allowing exploration of the GET1/GET2/GET3 complex

  • Trafficking assay results:

    • Present time-series data showing dynamic changes in protein localization

    • Use kymographs to visualize trafficking events along defined cellular paths

    • Implement box plots or violin plots to compare trafficking efficiency across experimental conditions

  • Multi-omics data integration:

    • Develop Sankey diagrams to show how GET1 perturbations affect downstream processes

    • Use clustered heat maps to visualize how GET1 mutations impact global protein expression patterns

    • Implement principal component analysis plots to identify patterns in complex datasets

When designing visualizations, prioritize clarity and accuracy over visual complexity. Each visualization should directly address specific research questions about GET1 function or interactions, following rigorous experimental design principles .

How can I address solubility issues with recombinant GET1 protein?

Addressing solubility issues with recombinant Zygosaccharomyces rouxii GET1 protein requires a systematic approach targeting the membrane protein nature of GET1:

  • Optimization of expression conditions:

    • Test multiple E. coli strains specifically designed for membrane protein expression

    • Evaluate expression at lower temperatures (16-20°C) to allow proper folding

    • Consider codon-optimization of the GET1 sequence for the expression host

    • Experiment with induction parameters (inducer concentration, time)

  • Buffer optimization strategies:

    • Test a range of pH conditions (typically 7.0-8.5) for maximal stability

    • Evaluate different salt concentrations to minimize aggregation

    • Add stabilizing agents such as glycerol (5-50%) or trehalose (as present in the storage buffer)

    • Consider mild detergents appropriate for membrane proteins (DDM, LMNG, or digitonin)

  • Solubilization approaches:

    • Implement a detergent screening panel to identify optimal solubilization conditions

    • Consider nanodiscs or amphipols as alternatives to detergents

    • Test lipid-based systems that mimic the native membrane environment

  • Protein engineering solutions:

    • Evaluate different tag positions (N-terminal vs. C-terminal)

    • Consider fusion partners known to enhance solubility (MBP, SUMO, or TrxA)

    • Design constructs with flexible linkers between domains

  • Refolding strategies (if inclusion bodies form):

    • Develop a gentle solubilization protocol using chaotropic agents

    • Implement step-wise dialysis to remove denaturants

    • Use chaperone co-expression systems to aid proper folding

When troubleshooting, maintain careful documentation of all conditions tested and their outcomes. Following experimental design principles, systematically vary one parameter at a time while controlling others to identify the specific factors affecting GET1 solubility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.