Recombinant Zygosaccharomyces rouxii High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Function of SHO1 in Osmoregulation

SHO1 is a transmembrane protein that acts as a co-osmosensor in the HOG pathway, detecting hyperosmotic stress. In S. cerevisiae, SHO1 interacts with membrane-bound proteins like Opy2 and mucins (e.g., Hkr1, Msb2) to activate a MAP kinase cascade, ultimately regulating glycerol production and stress-responsive gene expression .

ParameterDescriptionSource
SpeciesSaccharomyces cerevisiae (SHO1)
RoleOsmosensor in HOG pathway; activates Hog1p MAPK via Ste20/Cla4 and Ste11
ExpressionExpressed in E. coli as a recombinant protein with an N-terminal His tag
Protein LengthFull-length (1–367 aa)
Key InteractionsBinds Cdc42, Cdc24, and Ste11 to transmit signals upstream of Hog1p

Relevance to Zygosaccharomyces rouxii

While no direct data on Z. rouxii SHO1 exists in the provided sources, insights from S. cerevisiae and other osmotolerant yeasts suggest potential parallels:

  • Osmoadaptation: Z. rouxii employs polyols (e.g., glycerol, D-arabitol) for osmoprotection, regulated by transporters like Fps1 and Fsy1 .

  • HOG Pathway Homologs: Z. rouxii likely possesses a functional HOG pathway, as evidenced by its survival in extreme osmotic environments .

ParameterS. cerevisiae SHO1Potential Z. rouxii Analog
OsmolytesGlycerolGlycerol, D-arabitol, trehalose
TransportersFps1 (glycerol channel)ZrFps1 (glycerol/D-arabitol efflux)
Stress ResponseHog1p-mediated gene expression (e.g., ENA1, HAL1)Upregulation of cell wall remodeling genes (e.g., FKS1, UTR2)

Gaps in Knowledge and Future Directions

The absence of data on Z. rouxii SHO1 highlights critical gaps:

  • Lack of Recombinant SHO1: No studies report heterologous expression or functional analysis of Z. rouxii SHO1.

  • HOG Pathway Specificity: Differences in osmolyte utilization (e.g., D-arabitol vs. glycerol) may necessitate distinct signaling mechanisms.

  • Experimental Validation: Genetic deletion or CRISPR-based studies are needed to confirm SHO1’s role in Z. rouxii.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
SHO1; ZYRO0B04004g; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Target Names
SHO1
Target Protein Sequence
MVMDKVPMPSRAKAKAQRKKLHINHSFSLNNLFSDPFALSSISITLLSWCIAIAGCIATA SDTDNFPRFTWWGIAYQFLILFMVIIFYCYDMVDYYKNFIAGATAVSFVYNTNSATILVY GDGSRKAAASAGVILLSIVNLIWIFYYGSDNASPTSRWIDSFSLRGIRPSATQDASMRAR RRNRNNLRSQRFTGDNFYPEHQPQNYMSSMALTGFENPDPAYYTGPNVPLDRNGSVAYSD NNMPGAFTQDMNANNQNNLNPNNFNQNNSNQNTFNQNTFMTETSNGNTDTTMGGTLELYS DAGEESFPYTAQTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSN YVKLIEDNIAM
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Zygosaccharomyces rouxii and why is it significant for research?

Zygosaccharomyces rouxii is an osmotolerant yeast species that has evolved remarkable ability to survive in extreme high sugar environments. This adaptation makes it particularly valuable for studying mechanisms of stress tolerance in eukaryotic cells . Z. rouxii is commonly associated with food fermentation processes, including soy sauce and balsamic vinegar manufacturing . Its exceptional osmotolerance capabilities make it an ideal model organism for investigating cellular responses to osmotic stress and related signaling pathways. The species has gained significant research attention for its unique physiological properties that enable survival under conditions that would be lethal to many other yeasts.

What is the High Osmolarity Glycerol (HOG) pathway and how does SHO1 fit into it?

The High Osmolarity Glycerol (HOG) pathway is a conserved signaling cascade in yeasts that coordinates adaptation to high osmolarity conditions. This pathway activates the Hog1 MAP kinase, which orchestrates cellular responses to osmotic stress . SHO1 (High osmolarity signaling protein 1) functions as an osmosensor in the HKR1 sub-branch of the HOG pathway, detecting changes in external osmolarity and initiating signal transduction.

Within this pathway, SHO1 plays dual roles:

  • As an osmosensor that detects changes in environmental osmolarity

  • As a scaffold protein that facilitates signal transduction by organizing multiple pathway components

When high external osmolarity is detected, SHO1 undergoes structural changes in its transmembrane domains, which enables its binding to the cytoplasmic adaptor protein Ste50. This interaction subsequently leads to Hog1 activation through the Ste20–Ste11–Pbs2–Hog1 kinase cascade . The activation of this pathway ultimately leads to cellular adaptations that enable survival under osmotic stress conditions.

What is the structural organization of the SHO1 protein?

SHO1 is a four-transmembrane (TM) domain protein that forms a complex oligomeric structure. Based on research findings, SHO1 adopts a "dimers-of-trimers" architecture through specific organizational principles:

  • Dimerization occurs at the TM1/TM4 interface

  • Trimerization takes place at the TM2/TM3 interface

This results in planar oligomers with a specialized structure that facilitates both osmosensing and scaffolding functions . The four transmembrane domains are critical for SHO1's function, as they:

  • Dictate the oligomeric structure

  • Enable osmosensing capabilities

  • Provide binding interfaces for other pathway components

When osmotic stress occurs, these transmembrane domains undergo structural changes that trigger downstream signaling events. The architecture allows SHO1 to form multi-component signaling complexes by binding to transmembrane proteins Opy2 and Hkr1 at the TM1/TM4 and TM2/TM3 interfaces, respectively .

What experimental approaches are most effective for studying SHO1 protein-protein interactions?

To investigate SHO1 protein-protein interactions effectively, researchers should consider a multi-method approach that combines the following techniques:

  • Co-immunoprecipitation (Co-IP) assays: This method has been successfully used to detect osmostress-induced interactions between SHO1 and adaptor proteins like Ste50. As demonstrated in previous research, wild-type Ste50–SHO1 interaction can be induced by osmotic stress and detected through Co-IP . This approach requires:

    • Generation of epitope-tagged versions of SHO1 and potential interacting partners

    • Optimization of cell lysis conditions to preserve membrane protein interactions

    • Validation with appropriate controls including hyperactive mutants (e.g., Ste50-D146F)

  • Crosslinking studies: This approach has been instrumental in elucidating the oligomeric structure of SHO1. Chemical crosslinking combined with mass spectrometry can identify specific residues involved in protein-protein interactions .

  • Yeast two-hybrid (Y2H) analysis: While challenging for membrane proteins, modified split-ubiquitin Y2H systems can be used to detect interactions involving the cytoplasmic domains of SHO1.

  • Fluorescence resonance energy transfer (FRET): For investigating dynamic protein-protein interactions in living cells, particularly useful for monitoring stress-induced changes in real-time.

  • Bimolecular fluorescence complementation (BiFC): To visualize the subcellular localization of protein interactions under different osmotic conditions.

A comprehensive experimental design should include both steady-state and kinetic measurements, as SHO1 interactions are often transient and stress-dependent.

How can researchers effectively express and purify recombinant Z. rouxii SHO1 protein for structural studies?

The purification of recombinant Z. rouxii SHO1 presents unique challenges due to its multiple transmembrane domains. A systematic approach includes:

  • Expression system selection:

    • E. coli-based systems with specialized strains (C41/C43) designed for membrane protein expression

    • Yeast expression systems (P. pastoris or S. cerevisiae) that may provide more native-like post-translational modifications

    • Insect cell expression systems for higher eukaryotic processing

  • Construct optimization:

    • Design constructs with removable fusion tags (His6, MBP, or SUMO) to enhance solubility

    • Consider expressing individual domains or truncated versions for domain-specific studies

    • Incorporate TEV or PreScission protease sites for tag removal

  • Membrane protein solubilization:

    • Screen detergent panels including DDM, LMNG, or digitonin

    • Test newer amphipols or nanodiscs for maintaining native structure

    • Optimize detergent:protein ratios to prevent aggregation

  • Purification strategy:

    • Multi-step approach combining affinity chromatography (IMAC)

    • Size exclusion chromatography to separate oligomeric states

    • Ion exchange chromatography for final polishing

  • Quality control assessments:

    • SEC-MALS to determine oligomeric state

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to evaluate stability in different buffer conditions

The success of structural studies depends heavily on protein sample quality and homogeneity. Researchers should expect to iterate through multiple conditions to optimize protein yield and stability.

What are the recommended methods for analyzing SHO1-mediated signaling dynamics in Z. rouxii?

Analysis of SHO1-mediated signaling dynamics requires methods that can capture both temporal and spatial aspects of signal transduction. The following approaches are recommended:

  • Phosphorylation-specific assays:

    • Western blotting with phospho-specific antibodies to monitor Hog1 activation kinetics

    • Phos-tag SDS-PAGE for comprehensive phosphorylation profiling

    • Mass spectrometry-based phosphoproteomics to identify novel phosphorylation sites

  • Real-time monitoring systems:

    • FRET-based biosensors to track conformational changes in SHO1 upon osmostress

    • Live-cell imaging with fluorescently tagged pathway components

    • Microfluidic devices coupled with time-lapse microscopy to precisely control osmotic shifts

  • Transcriptional readouts:

    • RNA-seq to identify genes whose expression is dependent on SHO1-mediated signaling

    • Reporter gene assays (e.g., lacZ or luciferase) driven by osmostress-responsive promoters

    • Single-cell transcriptomics to capture cell-to-cell variability in responses

  • Genetic approaches:

    • CRISPR-Cas9 mediated genome editing to generate specific SHO1 variants

    • Domain swapping between Z. rouxii and S. cerevisiae SHO1 to identify species-specific functions

    • Synthetic genetic array analysis to map genetic interactions

A comprehensive experimental design should integrate multiple approaches to develop a systems-level understanding of SHO1-mediated signaling in Z. rouxii.

How does Z. rouxii SHO1 differ from its homologs in other yeast species, particularly S. cerevisiae?

The SHO1 protein in Z. rouxii exhibits several notable differences from its S. cerevisiae counterpart, reflecting evolutionary adaptations to different ecological niches:

  • Sequence divergence: While maintaining the core four-transmembrane domain structure, Z. rouxii SHO1 shows sequence variations particularly in the cytoplasmic domains that interact with downstream signaling components. These differences may contribute to enhanced osmotolerance.

  • Signaling thresholds: Z. rouxii SHO1 likely has evolved to respond to higher osmotic stresses compared to S. cerevisiae, consistent with Z. rouxii's natural habitat in high sugar environments . This adaptation may involve:

    • Modified sensor sensitivity

    • Altered binding affinities for interaction partners

    • Different activation thresholds for downstream signaling

  • Pathway integration: In Z. rouxii, SHO1 may have additional interactions with stress response pathways beyond the canonical HOG pathway, potentially integrating multiple stress signals relevant to high sugar environments.

  • Oligomerization dynamics: While both form oligomeric structures, the dynamics and regulation of oligomerization may differ between species, affecting their sensing and scaffolding capabilities.

  • Response kinetics: Z. rouxii SHO1 likely mediates faster or more sustained pathway activation compared to S. cerevisiae to accommodate the extreme osmotic conditions it encounters.

These differences highlight how evolutionary pressures have shaped signaling proteins to optimize cellular responses to specific environmental challenges.

What role does SHO1 play in Z. rouxii's exceptional osmotolerance compared to other yeasts?

Z. rouxii's remarkable ability to thrive in environments with up to 60% w/v sugar concentrations is significantly influenced by SHO1's specialized functions:

  • Enhanced osmosensing capacity: Z. rouxii SHO1 likely possesses adaptations that enable detection of a wider range of osmotic conditions, particularly at the extreme high end that would be lethal to other yeasts.

  • Integrated stress response coordination: Beyond osmosensing, SHO1 in Z. rouxii appears to coordinate multiple stress responses. For example, research indicates connections between osmotic stress pathways and oxidative stress responses:

    • The polyamine transporter gene TPO1 is upregulated 24.8-fold after 4 hours of sugar stress in Z. rouxii but downregulated in S. cerevisiae

    • TPO1 has been linked to control of cell cycle delay and induction of antioxidant proteins like Hsp70 and Hsp90

  • Temporal regulation of response genes: Z. rouxii shows distinctive expression patterns for stress response genes:

    • ZrKAR2 (encoding Hsp70) is downregulated 5.7-fold after 4 hours of sugar stress

    • The same gene shows increased expression (2.9-fold and 8.2-fold) after 8 and 20 hours respectively

    • Kar2p protein levels increase dramatically (29-fold) after approximately 27 hours at 60% w/v sugar concentrations

This temporal pattern suggests SHO1 may coordinate a complex, multi-phase adaptive response that enables survival under extreme conditions.

  • Cell cycle regulation: SHO1-mediated signaling in Z. rouxii appears to induce cell cycle delay as part of the stress adaptation mechanism, potentially providing time for comprehensive cellular adaptation to extreme conditions .

These specialized functions collectively contribute to Z. rouxii's exceptional ability to survive in high-osmolarity environments that would be lethal to most other yeasts.

What considerations should be made when designing CRISPR-Cas9 experiments to study SHO1 function in Z. rouxii?

When designing CRISPR-Cas9 experiments to investigate SHO1 function in Z. rouxii, researchers should consider the following critical factors:

  • Guide RNA (gRNA) design:

    • Target sequence selection should account for Z. rouxii's AT-rich genome

    • Perform thorough off-target analysis specific to Z. rouxii genome

    • Design multiple gRNAs targeting different regions of SHO1 to improve success rate

    • Consider the four-transmembrane structure when targeting specific domains

  • Delivery methodology:

    • Optimize transformation protocols specifically for Z. rouxii

    • Consider electroporation for higher efficiency in this osmotolerant yeast

    • Evaluate both plasmid-based and ribonucleoprotein (RNP) delivery approaches

    • Test antibiotic selection markers functional in Z. rouxii

  • Repair template design:

    • Include sufficiently long homology arms (>500 bp) for efficient homology-directed repair

    • Design strategies for domain-specific mutations to dissect SHO1 function

    • Consider markerless editing strategies for multiple sequential modifications

    • Incorporate silent mutations in the PAM site to prevent re-cutting

  • Phenotypic analysis:

    • Develop robust assays to measure osmotolerance under various conditions

    • Design experiments to test both gradual and acute osmotic stress responses

    • Include analysis of growth rates, cell morphology, and viability

    • Implement microscopy-based approaches to study SHO1 localization and dynamics

  • Control experiments:

    • Generate complementation strains to confirm phenotype specificity

    • Create domain deletion variants to dissect function

    • Include wild-type controls subjected to identical experimental conditions

    • Consider creating humanized versions with S. cerevisiae SHO1 for comparative studies

How can researchers accurately measure the structural changes in SHO1 transmembrane domains during osmotic stress?

Accurately measuring structural changes in SHO1 transmembrane domains during osmotic stress requires specialized techniques that can detect subtle conformational shifts in membrane proteins:

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy:

    • Strategic placement of spin labels at key residues within transmembrane domains

    • Continuous wave EPR to monitor local environment changes

    • DEER (Double Electron-Electron Resonance) for measuring distance changes between domains

    • Time-resolved measurements to capture dynamic structural transitions

  • Cysteine accessibility methods:

    • Introduction of cysteine residues at strategic positions within TM domains

    • Differential labeling with membrane-permeable and impermeable reagents

    • Quantification of accessibility changes upon osmotic stress

    • Combined with mass spectrometry for precise identification of modified residues

  • FRET-based approaches:

    • Incorporation of fluorescent pairs at critical interfaces (TM1/TM4 and TM2/TM3)

    • Live-cell FRET imaging during osmotic shock experiments

    • Single-molecule FRET for detecting conformational heterogeneity

    • Development of FRET sensors specifically designed for TM domain movements

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Optimized for membrane proteins in detergent or nanodisc environments

    • Time-course analysis to identify regions with altered solvent accessibility

    • Comparison of exchange patterns under different osmotic conditions

    • Integration with computational modeling for structural interpretation

  • Cryo-electron microscopy approaches:

    • Sample preparation under defined osmotic conditions

    • Single-particle analysis to capture different conformational states

    • Comparison of structures before and after osmotic stress

    • Subtomogram averaging for in situ structural studies

Each method provides complementary information, and a comprehensive understanding will likely require integration of multiple approaches.

How does Z. rouxii SHO1 integrate signals from multiple stress pathways beyond osmotic stress?

Z. rouxii SHO1 functions as a sophisticated signal integration hub that coordinates responses to multiple stressors commonly encountered in high-sugar environments:

  • Cross-talk with oxidative stress response:

    • Evidence suggests SHO1 signaling is linked to oxidative stress responses in Z. rouxii

    • The dramatic upregulation (24.8-fold) of polyamine transporter TPO1 after sugar stress in Z. rouxii (compared to downregulation in S. cerevisiae) suggests SHO1-mediated integration of osmotic and oxidative stress responses

    • TPO1 has been implicated in controlling cell cycle delay and mediating induction of antioxidant proteins including Hsp70 and Hsp90

  • Temporal coordination of stress responses:

    • SHO1 appears to orchestrate a temporally regulated response program as evidenced by the expression pattern of ZrKAR2 (encoding Hsp70):

      • Initial downregulation (5.7-fold) after 4 hours of sugar stress

      • Progressive upregulation after 8 hours (2.9-fold) and 20 hours (8.2-fold)

      • Substantial increase in Kar2p protein levels (29-fold) after approximately 27 hours

  • Cell cycle regulation interface:

    • SHO1-mediated signaling in Z. rouxii induces cell cycle delay as part of stress adaptation

    • This mechanism may provide a critical temporal window for comprehensive cellular reprogramming

    • The coordination between osmotic sensing and cell cycle control represents a sophisticated integration mechanism

  • Protein quality control pathway integration:

    • SHO1 likely coordinates with protein folding and quality control pathways

    • The delayed but substantial induction of molecular chaperones like Kar2p suggests SHO1 influences proteostasis networks

    • This integration may be particularly important in extreme environments where protein misfolding pressures are high

  • Metabolic pathway coordination:

    • SHO1 signaling likely influences metabolic adaptations required for growth in high-sugar environments

    • This includes regulation of glycerol production and carbohydrate metabolism

    • The integration of osmosensing with metabolic control enables Z. rouxii to maintain cellular homeostasis under extreme conditions

This multi-pathway integration capability represents a sophisticated adaptation that contributes significantly to Z. rouxii's exceptional stress tolerance.

What are the critical residues in Z. rouxii SHO1 that determine its osmosensing function, and how can they be experimentally validated?

The identification and validation of critical residues in Z. rouxii SHO1 that determine its osmosensing function requires a systematic approach combining computational prediction with experimental validation:

Key Residue Types to Investigate:

  • Transmembrane domain interface residues:

    • Residues at the TM1/TM4 dimerization interface

    • Residues at the TM2/TM3 trimerization interface

    • These interfaces are crucial for the formation of the functional "dimers-of-trimers" architecture

  • Residues involved in conformational changes:

    • Proline residues that may function as molecular hinges

    • Charged or polar residues within or adjacent to transmembrane domains

    • Residues that become exposed or buried during osmotic stress-induced conformational changes

  • Protein-protein interaction sites:

    • Residues mediating interaction with the adaptor protein Ste50

    • Residues involved in binding transmembrane proteins Opy2 and Hkr1

    • Cytoplasmic domain residues that interact with downstream signaling components

Experimental Validation Approaches:

  • Site-directed mutagenesis combined with functional assays:

    • Systematic alanine scanning of predicted key residues

    • Construction of chimeric proteins with corresponding regions from S. cerevisiae

    • Generation of point mutations based on computational predictions

    • Functional validation using growth assays under various osmotic conditions

  • Structure-guided approaches:

    • Homology modeling based on available structural data

    • Molecular dynamics simulations to predict conformational changes

    • In silico prediction of critical residues followed by targeted mutagenesis

  • Biochemical validation:

    • Crosslinking studies to identify residues at oligomerization interfaces

    • Membrane insertion analysis using glycosylation mapping

    • Accessibility studies using substituted-cysteine accessibility method

  • Signaling readouts:

    • Phosphorylation assays to measure HOG pathway activation

    • Reporter gene assays to quantify downstream transcriptional responses

    • Protein-protein interaction assays to measure binding to pathway components

Statistical Analysis Framework:

Mutation TypeGrowth Inhibition (%)HOG Pathway Activation (% of WT)Protein-Protein Interaction (% of WT)Oligomerization State
Wild-type0100100Dimers-of-trimers
TM1/TM4 interfaceVariableVariableVariablePotentially altered
TM2/TM3 interfaceVariableVariableVariablePotentially altered
Ste50 binding siteVariableVariableVariableLikely unchanged
Conformational hingesVariableVariableVariablePotentially altered

By systematically characterizing these mutations across multiple functional readouts, researchers can identify residues that specifically affect osmosensing without disrupting general protein structure or expression.

How can understanding Z. rouxii SHO1 function contribute to engineering yeasts with enhanced stress tolerance for industrial fermentations?

Understanding Z. rouxii SHO1 function offers several strategic approaches for engineering enhanced stress tolerance in industrial yeast strains:

  • Heterologous expression of Z. rouxii SHO1:

    • Introduction of the complete Z. rouxii SHO1 gene into industrial Saccharomyces strains

    • Development of chimeric SHO1 proteins combining domains from Z. rouxii and host organisms

    • Fine-tuning expression levels to optimize stress response without growth penalties

  • Pathway engineering based on SHO1 insights:

    • Modification of HOG pathway components based on Z. rouxii-specific adaptations

    • Engineering of downstream transcriptional targets identified in Z. rouxii

    • Introduction of Z. rouxii-specific stress response elements into industrial strains

  • Temporal response optimization:

    • Engineering the timing of stress responses based on Z. rouxii's multi-phase adaptation

    • Implementation of synthetic biology approaches to recreate the temporal regulation observed in Z. rouxii, such as the delayed but substantial induction of chaperones like Kar2p

    • Development of synthetic genetic circuits that mimic Z. rouxii's stress response dynamics

  • Hybrid strain development:

    • Creation of interspecies hybrids between Z. rouxii and industrial yeasts

    • Exploration of genome shuffling approaches to combine beneficial traits

    • Selection strategies focusing on the maintenance of Z. rouxii stress tolerance mechanisms

This knowledge can be applied to develop industrial strains with improved tolerance to multiple stresses encountered during fermentation processes, including:

  • High sugar/osmotic stress in wine and brewing fermentations

  • Ethanol tolerance in biofuel production

  • Acid tolerance in food fermentations

  • Temperature fluctuations in industrial processes

The successful engineering of these traits could significantly enhance productivity and reduce costs in various biotechnological applications.

What methodologies are most effective for studying the function of Z. rouxii SHO1 in heterologous expression systems?

When investigating Z. rouxii SHO1 function in heterologous expression systems, researchers should consider these methodological approaches:

  • Expression system selection and optimization:

    • S. cerevisiae as a model host:

      • Closest related model organism with well-established genetic tools

      • Create SHO1 deletion strains complemented with Z. rouxii SHO1

      • Generate strains expressing both native and Z. rouxii SHO1 to study dominant effects

    • Industrial yeast platforms:

      • Brewing, wine, or bioethanol production strains

      • Development of inducible expression systems appropriate for industrial strains

      • Integration at neutral genomic loci to ensure stable expression

    • Non-yeast expression systems:

      • Mammalian cell lines for structural studies requiring higher protein yields

      • Insect cells for functional studies of membrane protein complexes

      • E. coli-based cell-free systems for rapid variant screening

  • Promoter and expression level optimization:

    • Testing constitutive versus inducible promoters

    • Development of osmotic stress-responsive promoters

    • Evaluation of native Z. rouxii promoters in heterologous contexts

  • Functional complementation analysis:

    • Cross-species complementation assays

    • Growth phenotyping under defined osmotic stress conditions

    • Microscopy-based localization studies

    • Pathway activation measurements using phospho-specific antibodies or reporter systems

  • Protein modification considerations:

    • Addition of epitope tags for detection and purification

    • Fluorescent protein fusions for localization and dynamics studies

    • Split reporter systems for protein-protein interaction analysis

    • Development of nanobodies or intrabodies specific to Z. rouxii SHO1

  • Comparative analysis framework:

Expression HostAdvantagesLimitationsRecommended Applications
S. cerevisiaeSimilar cellular environment, established geneticsPotential interference from native SHO1Functional complementation, pathway studies
Industrial yeastsDirect assessment of industrial relevanceLimited genetic tools, strain variabilityStress tolerance phenotyping, fermentation performance
Pichia pastorisHigh expression levels, post-translational modificationsLess characterized HOG pathwayProtein production for structural studies
Mammalian cellsComplex glycosylation, human-relevant insightsDifferent membrane compositionDrug screening, therapeutic applications
Cell-free systemsRapid testing, controlled environmentLack of cellular contextBiochemical assays, interaction studies

These methodologies provide a comprehensive framework for dissecting Z. rouxii SHO1 function in diverse contexts, enabling both fundamental biological insights and biotechnological applications.

What bioinformatic approaches can identify the evolutionary adaptations in Z. rouxii SHO1 that contribute to extreme osmotolerance?

To identify evolutionary adaptations in Z. rouxii SHO1 that contribute to extreme osmotolerance, researchers should implement a multi-layered bioinformatic approach:

  • Comparative sequence analysis:

    • Multiple sequence alignment of SHO1 from diverse yeast species with varying osmotolerance

    • Calculation of site-specific evolutionary rates to identify rapidly evolving residues

    • Detection of episodic positive selection using methods like MEME (Mixed Effects Model of Evolution)

    • Analysis of co-evolving residue networks using approaches like Statistical Coupling Analysis or Direct Coupling Analysis

  • Structural bioinformatics:

    • Homology modeling of Z. rouxii SHO1 based on available structural data

    • Molecular dynamics simulations under varying osmotic conditions

    • Identification of conformational differences between Z. rouxii SHO1 and less osmotolerant homologs

    • Analysis of transmembrane domain packing and interface residues

  • Systems biology approaches:

    • Network analysis comparing HOG pathway architecture across species

    • Integration of transcriptomic data to identify Z. rouxii-specific pathway components

    • Flux balance analysis to predict metabolic adaptations coordinated with SHO1 signaling

    • Bayesian network modeling to infer causal relationships in stress response networks

  • Ancestral sequence reconstruction:

    • Inference of ancestral SHO1 sequences at key evolutionary nodes

    • Resurrection and functional testing of ancestral proteins

    • Identification of historical mutations that correlate with increased osmotolerance

    • Experimental validation of predicted adaptive mutations

  • Machine learning applications:

    • Development of predictive models for osmotolerance based on sequence features

    • Feature importance analysis to identify key sequence determinants

    • Transfer learning approaches leveraging data from model organisms

    • Deep mutational scanning data analysis to map sequence-function relationships

By integrating these computational approaches with targeted experimental validation, researchers can develop a comprehensive understanding of the evolutionary innovations that enable Z. rouxii's exceptional stress tolerance through SHO1-mediated signaling.

How can researchers effectively analyze large-scale omics data to understand the global impact of SHO1 signaling in Z. rouxii?

Analyzing large-scale omics data to understand the global impact of SHO1 signaling in Z. rouxii requires sophisticated analytical frameworks that integrate multiple data types:

  • Integrative multi-omics approaches:

    • Correlation analysis across transcriptomics, proteomics, and metabolomics data

    • Multi-layer network construction incorporating regulatory, metabolic, and signaling interactions

    • Time-course analysis to capture dynamic responses at different levels

    • Development of causal inference models connecting SHO1 activity to downstream effects

  • Differential expression analysis strategies:

    • Comparison between wild-type and SHO1 mutant strains under varying osmotic conditions

    • Time-resolved analysis to capture the multi-phase response observed in Z. rouxii

    • Pathway enrichment analysis to identify biological processes affected by SHO1

    • Correlation of expression patterns with growth and survival phenotypes

  • Network-based analytical frameworks:

    • Construction of gene regulatory networks specific to Z. rouxii

    • Identification of network motifs and regulatory hubs connected to SHO1 signaling

    • Comparative network analysis with S. cerevisiae to identify Z. rouxii-specific adaptations

    • Network perturbation simulations to predict effects of SHO1 modifications

  • Data visualization and exploration tools:

    • Interactive visualization platforms for multi-dimensional omics data

    • Comparative visualization across conditions and time points

    • Pathway visualization integrating expression data with known stress response pathways

    • Custom visualization solutions for Z. rouxii-specific genomic features

  • Statistical framework for integrated analysis:

Data TypeKey Analysis ApproachesExpected InsightsIntegration Strategy
TranscriptomicsDifferential expression, Co-expression modulesTranscriptional programs activated by SHO1Core dataset for integration
ProteomicsProtein abundance changes, Post-translational modificationsSignaling dynamics, Protein stability changesMap to transcriptional changes
PhosphoproteomicsKinase activity inference, Pathway activation analysisDirect signaling outputs of HOG pathwayConnect to transcriptional regulators
MetabolomicsPathway flux analysis, Osmolyte productionMetabolic adaptations to osmotic stressLink to gene expression changes
PhenomicsGrowth measurements, Stress survival quantificationPhysiological consequences of pathway activityCorrelate with molecular changes

By implementing these analytical approaches, researchers can develop a systems-level understanding of how SHO1 signaling coordinates the remarkable osmoadaptation capabilities of Z. rouxii, potentially revealing novel mechanisms that could be exploited for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.