Recombinant Zygosaccharomyces rouxii Monopolar spindle protein 2 (MPS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MPS2; ZYRO0G08712g; Monopolar spindle protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Target Names
MPS2
Target Protein Sequence
MDFDKSSSSLVLDLAWNQVDKKNQDFIYAKDFPALIMSIEEILSRGQQTPLAFLSNTGKS VIDTFAREKEFFKIYRDEFKEIFHGLVGKTFKDTIEGTNVSRSVLDEQGQEPDVSTTPTR QQRSSPRKVNRLLKNLETRVASMKDELKFKDEILAEKDRELIQLTRKLSDYKDKYEFVQR QFSFYKDHGESPRRNSSESEQLNLEQNASTKHEFIISELKRKLQEQTLAISNLKEQLQRG EGAGVLYTNYSKRYNPLHNDGPMVLVLATLVFLTIILLIGSMIWVTGGKDDSNSFSQYSW WENNSLLSRIGWFFRDWSDTGVDYVNFEPSSDAYERIMGIRRI
Uniprot No.

Target Background

Function
Monopolar spindle protein 2 (MPS2) is a component of the spindle pole body (SPB). It plays a crucial role in the insertion of the nascent SPB into the nuclear envelope and the proper execution of SPB duplication.
Database Links
Protein Families
MPS2 family
Subcellular Location
Nucleus membrane; Single-pass membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body.

Q&A

What is the biological role of Monopolar spindle protein 2 in Z. rouxii?

MPS2 in Z. rouxii likely functions similarly to its homologs in other yeasts as an essential component of the spindle pole body (SPB). It is involved in SPB duplication and insertion into the nuclear envelope during mitosis. This protein plays a critical role in ensuring proper chromosome segregation during cell division, which is particularly important for maintaining genomic stability in this allodiploid yeast . Since Z. rouxii can exist as a hybrid with two subgenomes, as observed in strain NBRC110957, proper chromosome segregation mediated by functional MPS2 may be particularly critical for maintaining genomic integrity across multiple subgenomes .

What are the most effective methods for recombinant MPS2 expression in Z. rouxii?

Methodological Approach:

For recombinant expression of MPS2 in Z. rouxii, researchers should consider an approach similar to that used for genetic manipulation of this organism in previous studies:

  • Vector Selection: Choose shuttle vectors compatible with Z. rouxii, potentially adapting those used successfully for transformation in studies examining ZrKAR2 .

  • Promoter Selection: Use either native Z. rouxii promoters or those known to function in this organism. For constitutive expression, promoters active during normal growth phases are recommended.

  • Transformation Protocol: Apply LiAc-based transformation methods as demonstrated effective for Z. rouxii in the ZrKAR2 studies .

  • Expression Conditions: Optimize fermentation conditions based on Z. rouxii growth characteristics, considering that optimal growth occurs at 30°C with shaking at approximately 200 rpm .

  • Selection Strategy: Use appropriate selective markers, such as G418 resistance (KanMX gene) as demonstrated in previous Z. rouxii genetic studies .

Expression System ComponentRecommended OptionsConsiderations
PromoterNative Z. rouxii promotersMay provide more natural expression levels
Strong constitutive promotersFor high-level expression
Selection MarkerKanMX (G418 resistance)Demonstrated effectiveness in Z. rouxii
Growth MediaYPD (10g/L yeast extract, 20g/L peptone, 20g/L glucose)Standard growth medium for expression
Growth Conditions30°C, 200 rpm shakingOptimal for Z. rouxii growth
Induction TimingLate exponential phaseOptimal for protein expression

How can gene knockout approaches be used to study MPS2 function in Z. rouxii?

To study MPS2 function through gene deletion, researchers should employ homologous recombination strategies as demonstrated for other Z. rouxii genes:

  • Design of deletion cassette: Create a deletion construct containing a selectable marker (such as KanMX) flanked by homologous sequences targeting the MPS2 locus. Design primers similar to the interrupt primers approach used for ZrKAR2 deletion .

  • Transformation: Use the LiAc transformation method to introduce the deletion cassette into Z. rouxii .

  • Selection and confirmation: Select transformants on media containing G418, then confirm deletion by PCR and sequencing as demonstrated in the ZrKAR2 deletion studies .

  • Phenotypic analysis: Since MPS2 is likely essential, a complete deletion may be lethal. Consider conditional knockout approaches or analysis of heterozygous deletions in diploid strains, particularly given Z. rouxii's nature as an allodiploid yeast .

  • Growth curve analysis: Analyze growth phenotypes using an automatic growth curve analyzer to compare wild-type and mutant strains under different conditions, as done for ZrKAR2 studies .

What purification strategies yield the highest purity recombinant Z. rouxii MPS2?

For optimal purification of recombinant MPS2 from Z. rouxii:

  • Affinity tag selection: Incorporate a 6xHis or GST tag to facilitate purification while minimizing interference with protein function.

  • Cell lysis optimization: Given Z. rouxii's osmotolerant nature, adjust lysis buffer conditions to account for potential differences in membrane composition compared to conventional yeasts.

  • Purification strategy:

    • Initial capture: Affinity chromatography using the incorporated tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Quality assessment: Analyze purified protein by SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity similar to methods used for analyzing proteins in Z. rouxii studies .

  • Activity verification: Develop functional assays specific to MPS2's role in spindle pole body function.

How does osmotic stress affect MPS2 function and localization in Z. rouxii?

Given Z. rouxii's remarkable osmotolerance, the relationship between osmotic stress and MPS2 function represents a significant research question. Z. rouxii can grow under extreme high sugar stress (60% w/v) while other yeasts cannot . This raises the possibility that spindle pole body proteins, including MPS2, may have specialized functions or regulations in this environment.

Methodological approach:

  • Fluorescent tagging: Generate Z. rouxii strains expressing fluorescently-tagged MPS2 to track localization under different osmotic conditions.

  • Microscopy analysis: Compare MPS2 localization patterns under standard conditions (2% w/v sugar) versus high osmotic stress (40% and 60% w/v sugar) .

  • Cell cycle analysis: Determine if MPS2 dynamics during cell division are altered under osmotic stress, particularly during the adaptation phase when cell cycle delay has been observed in Z. rouxii .

  • Protein interaction studies: Investigate whether MPS2 forms different protein complexes under osmotic stress, potentially interacting with osmotic stress response proteins.

  • Comparative analysis: Compare these responses to those observed in S. cerevisiae to identify Z. rouxii-specific adaptations.

What role does MPS2 play in maintaining genomic stability in hybrid Z. rouxii strains?

Z. rouxii can exist as an allodiploid hybrid with two subgenomes, as observed in strain NBRC110957 . This genomic architecture raises important questions about chromosome segregation fidelity and the role of spindle pole body proteins like MPS2.

Research approach:

  • Comparative genomics: Analyze MPS2 sequence conservation between the two subgenomes in hybrid Z. rouxii strains.

  • Allele-specific expression analysis: Determine if both MPS2 alleles are expressed equally or if there is preferential expression of one allele.

  • Chromosome segregation analysis: Develop fluorescent chromosome-labeling techniques to track segregation fidelity in wild-type versus MPS2-mutant strains.

  • Genetic interaction screening: Identify genetic interactions between MPS2 and other genes involved in genome stability maintenance specific to hybrid yeasts.

  • Evolutionary analysis: Compare MPS2 sequences across various Z. rouxii isolates with different ploidy states to identify adaptation signatures.

How does temperature affect MPS2 stability and function in Z. rouxii compared to other yeasts?

Experimental design:

  • Thermal stability assays: Compare the thermal stability profiles of purified recombinant MPS2 from Z. rouxii and other yeast species using differential scanning fluorimetry.

  • Temperature-dependent growth analysis: Culture Z. rouxii MPS2 mutants across temperature gradients to identify temperature-sensitive phenotypes, similar to the growth curve analysis approach used for ZrKAR2 studies .

  • In vivo protein stability: Measure MPS2 protein half-life at different temperatures using cycloheximide chase experiments.

  • Spindle pole body integrity analysis: Examine spindle pole body morphology and function across temperatures using electron microscopy and fluorescence techniques.

  • Complementation studies: Test whether Z. rouxii MPS2 can complement temperature-sensitive MPS2 mutants in S. cerevisiae.

What are common challenges in generating viable Z. rouxii MPS2 mutants and how can they be overcome?

Generating viable MPS2 mutants in Z. rouxii presents several challenges:

  • Essential gene function: If MPS2 is essential, complete deletion will be lethal. Solutions include:

    • Using conditional promoters to control expression

    • Generating temperature-sensitive alleles

    • Creating partial loss-of-function mutations

    • Utilizing heterozygous deletions in diploid backgrounds

  • Low transformation efficiency: Z. rouxii may have lower transformation efficiency than S. cerevisiae. Optimize by:

    • Adjusting growth phase for transformation (use late exponential phase cells)

    • Modifying LiAc concentration and transformation conditions

    • Increasing homology arm length for better recombination efficiency

  • Phenotype detection: Subtle phenotypes may be difficult to detect. Enhance detection by:

    • Using growth curve analysis under various conditions as demonstrated in ZrKAR2 studies

    • Employing microscopy to analyze spindle morphology

    • Developing high-throughput fitness assays specific to Z. rouxii

  • Genomic complexity in hybrid strains: Working with allodiploid Z. rouxii strains adds complexity. Address by:

    • Confirming which subgenome's MPS2 is being targeted

    • Designing allele-specific targeting strategies

    • Using CRISPR-Cas9 with guides specific to each allele

How can protein-protein interactions of MPS2 be effectively studied in Z. rouxii?

Methodological approaches:

  • Yeast two-hybrid (Y2H) adaptation for Z. rouxii:

    • Develop Z. rouxii-specific Y2H vectors

    • Optimize selection conditions accounting for Z. rouxii's growth characteristics

    • Screen for interactions under both standard and osmotic stress conditions

  • Co-immunoprecipitation (Co-IP):

    • Generate Z. rouxii strains expressing tagged MPS2

    • Optimize lysis conditions accounting for Z. rouxii's cell wall properties

    • Perform Co-IP followed by mass spectrometry to identify interacting partners

  • Bimolecular Fluorescence Complementation (BiFC):

    • Adapt BiFC vectors for expression in Z. rouxii

    • Optimize fluorescence detection accounting for Z. rouxii's autofluorescence properties

    • Analyze interactions under various growth conditions, particularly under osmotic stress

  • Proximity-based labeling:

    • Express MPS2 fused to BioID or APEX2 in Z. rouxii

    • Optimize biotin proximity labeling conditions for Z. rouxii

    • Identify proximal proteins by streptavidin pull-down and mass spectrometry

What are optimal conditions for analyzing MPS2 expression in Z. rouxii under varying environmental stresses?

Based on research with other Z. rouxii genes, the following approach is recommended:

  • Growth conditions: Cultivate Z. rouxii under different stress conditions:

    • Standard conditions: YPD (2% w/v glucose) at 30°C

    • Osmotic stress: 40% w/v glucose and 60% w/v glucose media

    • Temperature stress: Growth at varied temperatures

    • Other stresses: Salt, pH, oxidative stress

  • Sample collection timing: Collect samples at different growth phases:

    • Early exponential phase

    • Late exponential phase (OD600 around 0.8)

    • Stationary phase (after 36h in high sugar media)

  • RNA extraction optimization:

    • Adapt RNA extraction protocols to account for Z. rouxii's cell wall properties

    • Include additional cell disruption steps if necessary

  • Expression analysis methods:

    • RT-qPCR: Design primers specific to Z. rouxii MPS2

    • RNA-Seq: For genome-wide expression analysis alongside MPS2

    • Western blotting: For protein-level expression analysis

  • Data normalization strategy:

    • Select appropriate reference genes stable under the tested conditions

    • Account for growth rate differences under stress conditions

Stress ConditionSampling Time PointsExpected ChallengesRecommended Controls
Standard YPD24h, 48h, 72h Baseline expressionWild-type strain
Osmotic stress (40% glucose)24h, 48h, 72h + adaptation phaseCell cycle delay ZrKAR2 expression (known osmotic response)
Osmotic stress (60% glucose)24h, 48h, 72h + extended adaptationSevere growth inhibitionMonitor growth alongside expression
Temperature stressVarious time pointsHeat shock response interferenceHeat shock protein expression

How can researchers distinguish between direct and indirect effects of MPS2 mutation on Z. rouxii phenotypes?

To differentiate direct effects of MPS2 mutation from indirect effects:

  • Generate rescue strains: Complement MPS2 mutants with wild-type MPS2 to confirm phenotype reversibility.

  • Create separation-of-function mutants: Design mutations affecting specific domains of MPS2 to link particular functions to specific phenotypes.

  • Perform time-course analyses: Monitor cellular responses immediately following conditional MPS2 inactivation versus long-term adaptation.

  • Implement genome-wide approaches:

    • Transcriptomics: Compare expression profiles between wild-type and MPS2 mutants

    • Genetic interaction screening: Identify genes that enhance or suppress MPS2 mutant phenotypes

    • Phosphoproteomics: Detect signaling changes resulting from MPS2 dysfunction

  • Cross-species complementation: Test whether MPS2 from other yeasts can rescue Z. rouxii MPS2 mutants, helping to identify Z. rouxii-specific functions.

What statistical approaches are most appropriate for analyzing Z. rouxii MPS2 experimental data?

When analyzing experimental data related to Z. rouxii MPS2:

  • Growth curve analysis:

    • Apply logistic equation modeling as demonstrated effective for Z. rouxii growth curves in previous studies (R² values typically >0.99)

    • Use ANOVA with post-hoc tests to compare growth parameters across conditions

  • Expression data analysis:

    • For RT-qPCR: Use the 2^-ΔΔCt method with appropriate reference genes

    • For RNA-Seq: Apply DESeq2 or similar tools, accounting for Z. rouxii's genomic complexity

  • Microscopy data:

    • Quantify fluorescence intensity using appropriate image analysis software

    • Apply distribution fitting for localization pattern analysis

  • Protein interaction data:

    • Implement appropriate filtering to reduce false positives

    • Use enrichment analysis to identify significant interaction partners

  • Evolutionary analyses:

    • Apply phylogenetic methods to compare MPS2 sequences across Zygosaccharomyces species

    • Use selection pressure analyses to identify functionally important residues

How can researchers interpret MPS2 functional data in the context of Z. rouxii's adaptation to extreme environments?

When interpreting MPS2 functional data in Z. rouxii:

  • Comparative framework: Compare MPS2 function in Z. rouxii to its homologs in non-extremophile yeasts to identify adaptations specific to extreme environments.

  • Correlation with stress response: Analyze whether MPS2 function correlates with other known osmotic stress response mechanisms in Z. rouxii, such as those involving ZrKAR2 .

  • Evolutionary context: Consider Z. rouxii's evolutionary history, including its hybrid nature in some strains , when interpreting MPS2 functional data.

  • Pathway integration: Integrate MPS2 functional data with known osmoadaptation pathways in Z. rouxii.

  • Structural insights: Connect functional data to structural features of MPS2 that might confer stability under extreme conditions.

  • Cell cycle connection: Analyze the relationship between MPS2 function and the observed cell cycle delay in Z. rouxii under high sugar stress , which may represent an adaptation mechanism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.