Recombinant Zygosaccharomyces rouxii Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Zygosaccharomyces rouxii Probable Endonuclease LCL3 (LCL3)

Zygosaccharomyces rouxii Probable endonuclease LCL3 (LCL3) is an enzyme derived from the yeast Zygosaccharomyces rouxii . Endonucleases are enzymes that cleave phosphodiester bonds within a nucleic acid chain . LCL3 is classified as a probable endonuclease, suggesting it is predicted to have endonuclease activity based on its sequence and structural similarity to known endonucleases .

Characteristics of Zygosaccharomyces rouxii

Zygosaccharomyces rouxii is an osmotolerant yeast known for its ability to survive in high-sugar environments . It is relevant in food fermentation and spoilage due to its capacity to grow in high sugar and salt concentrations .

Properties of Recombinant LCL3

Recombinant LCL3 is produced using genetic engineering techniques, allowing for large-scale production and purification of the protein . Some properties include:

  • Source Organism: Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) also known as Candida mogii

  • Quantity: Available in 50 µg amounts

  • Purity: Expressed as a recombinant protein

  • Storage: Recommended storage at -20℃, with long-term storage at -20℃ or -80℃ to maintain stability

  • Storage Buffer: Supplied in Tris-based buffer with 50% glycerol, optimized for protein stability

  • Amino Acid Sequence: MGDNRNLPVTQPNSINFNVVILSIFFSGSFIGAWAFFNRFLKQYTKATEIPQNVFRKRWL FGKVTAVGDGDNFHFFHAPGGLIAGWGWLRPLPELNKSDPPISSSKVGSSVPIHRRIFDS IFGRNKTRTAYSNYFLGLPVPYKNKRNLPTISIRICGVDAPERAHFGNPAQPFSEEALIW LRHTLIGKCVWIKPLAVDQYNRCVAKVEYWTWTGWKNVSLEMVKQGLAVVYESKTSAEFD GEEDKYRFHEMAAKARRRGIWSQKQFETPGEYKRRI

  • Sequence Length: 1-276 amino acids

Potential Applications

While specific applications for recombinant LCL3 from Zygosaccharomyces rouxii are not detailed in the provided data, endonucleases, in general, have diverse applications:

  • Molecular Biology: Restriction endonucleases are used to cleave DNA at specific sites, which is essential for gene cloning, DNA mapping, and other molecular biology techniques .

  • Genetic Research: Restriction endonuclease analysis is used to study the transmission of microorganisms .

  • Biotechnology: Endonucleases can be employed in various biotechnological applications, including gene editing and development of diagnostic tools .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LCL3; ZYRO0G08272g; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Target Names
LCL3
Target Protein Sequence
MGDNRNLPVTQPNSINFNVVILSIFFSGSFIGAWAFFNRFLKQYTKATEIPQNVFRKRWL FGKVTAVGDGDNFHFFHAPGGLIAGWGWLRPLPELNKSDPPISSSKVGSSVPIHRRIFDS IFGRNKTRTAYSNYFLGLPVPYKNKRNLPTISIRICGVDAPERAHFGNPAQPFSEEALIW LRHTLIGKCVWIKPLAVDQYNRCVAKVEYWTWTGWKNVSLEMVKQGLAVVYESKTSAEFD GEEDKYRFHEMAAKARRRGIWSQKQFETPGEYKRRI
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Zygosaccharomyces rouxii and why is it significant for research?

Zygosaccharomyces rouxii is a non-conventional yeast species characterized by its exceptional halotolerance, osmotolerance, petite negative phenotype, and weak Crabtree positive characteristics. These traits, combined with its strong fermentative vigor, make it particularly appealing for industrial and food applications. Z. rouxii has become increasingly attractive in food and industrial biotechnology, though its exploitation has historically been limited by challenges in genetic manipulation . The species is known for its ability to grow in high-salt and high-sugar environments, which makes it both a spoilage concern in food preservation and a potentially valuable industrial organism. Z. rouxii strain ATCC 2623/CBS 732 represents one of the well-characterized reference strains of this species .

What is endonuclease LCL3 and what is its classification?

Endonuclease LCL3 (UniProt accession: C5DZY8) is classified as a probable endonuclease encoded in the Z. rouxii genome. Its designation as an EC 3.1.-.- enzyme indicates it belongs to the hydrolase family that acts on ester bonds, specifically phosphoric diester bonds . Endonucleases typically cleave phosphodiester bonds within nucleic acid chains (as opposed to exonucleases, which remove terminal nucleotides). Based on comparative analysis with other endonucleases, LCL3 likely plays a role in DNA metabolism processes such as DNA repair, recombination, or restriction, though its precise function remains to be fully characterized experimentally.

How does the cellular environment of Z. rouxii influence LCL3 function?

Z. rouxii's unique physiological characteristics create a distinct cellular environment that potentially influences LCL3 function. The yeast's exceptional osmotolerance suggests it maintains specialized mechanisms for stabilizing cellular components under osmotic stress. These conditions may affect:

  • Enzyme structure and stability - high intracellular solute concentrations could influence protein folding and activity

  • DNA topology and accessibility - altered ionic conditions may change how LCL3 interacts with nucleic acid substrates

  • Regulatory networks - stress response pathways likely modulate LCL3 expression and activity

Similar to how endonuclease III enzymes respond to cellular conditions in other organisms, LCL3 activity may be regulated by Z. rouxii's specialized metabolism and stress response systems .

How does LCL3 compare with other characterized endonucleases?

Comparative analysis of LCL3 with other endonucleases reveals important functional insights:

EndonucleaseOrganismPrimary FunctionCatalytic MechanismPotential Relation to LCL3
Endonuclease IIIE. coliDNA repair of oxidative pyrimidine damageDNA glycosylase activity with an iron-sulfur clusterMay share structural elements if LCL3 functions in DNA repair
Type III Restriction EndonucleasesVarious bacteriaDefense against foreign DNAATP-dependent DNA translocation; requires two inversely oriented sitesCould indicate potential restriction enzyme activity if structurally similar
Nucleoside diphosphate kinase (Ndk)E. coliProposed uracil repair activityLimited UDG activity on ssDNADemonstrates how diverse enzymes can possess nuclease functionality

This comparison highlights the diversity of endonuclease mechanisms and suggests potential functional roles for LCL3 in Z. rouxii cellular processes.

What are the predicted active sites and catalytic mechanisms of LCL3?

Based on sequence analysis and comparison with characterized endonucleases, the catalytic mechanism of LCL3 likely involves:

  • Metal ion coordination - conserved acidic residues (Asp, Glu) probably coordinate Mg²⁺ or Mn²⁺ ions essential for phosphodiester bond hydrolysis

  • Nucleophilic attack - activated water molecule likely serves as the nucleophile for hydrolyzing phosphodiester bonds

  • Substrate recognition - specific amino acid motifs determine DNA sequence or structure specificity

Similar to how endonuclease III operates in DNA repair pathways, LCL3 may use conserved structural elements to recognize specific DNA substrates . The sequence "RICGVDAPER" contains motifs consistent with metal ion coordination in other endonucleases. Experimental validation through site-directed mutagenesis would be required to confirm these predictions.

What expression systems are optimal for recombinant LCL3 production?

Developing efficient expression systems for LCL3 requires careful consideration of multiple factors:

  • Host Selection:

    • E. coli: Traditional choice for high yield, but may struggle with proper folding of yeast proteins

    • S. cerevisiae: Better for proper folding and post-translational modifications of yeast proteins

    • Z. rouxii itself: Homologous expression using recently developed genetic tools

  • Vector Design Elements:

    • Promoter selection: Strong inducible promoters (T7 for E. coli; GAL1 for yeast)

    • Affinity tags: N or C-terminal His6 or GST tags for purification

    • Fusion partners: MBP or SUMO to enhance solubility if needed

  • Optimization Strategy:

    • Codon optimization for the expression host

    • Temperature reduction during induction (16-25°C)

    • Supplementation with metal ions (Mg²⁺, Mn²⁺) if required for folding

For Z. rouxii expression specifically, recently developed centromeric and episomal vectors with dominant selection markers (KanMX and ClonNAT) provide valuable tools for homologous expression . These systems allow for expression under native regulatory elements or controlled promoters.

What are the optimal purification and storage conditions for LCL3?

Successful purification and storage of LCL3 require careful attention to conditions that maintain enzymatic activity:

  • Purification Protocol:

    • Initial capture: Affinity chromatography based on fusion tag

    • Secondary purification: Ion exchange or size exclusion chromatography

    • Buffer optimization: Tris-based buffer systems (pH 7.5-8.5) with 100-200 mM NaCl

  • Stability Considerations:

    • Metal ion inclusion: Supplement buffers with 1-5 mM MgCl₂ or MnCl₂

    • Reducing agents: Add 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation

    • Protease inhibitors: Use complete inhibitor cocktails during early purification steps

  • Storage Conditions:

    • Temperature: Store at -20°C for routine use or -80°C for long-term storage

    • Cryoprotection: Add glycerol to 50% final concentration

    • Aliquoting: Prepare single-use aliquots to avoid freeze-thaw cycles

According to product specifications, commercially available recombinant LCL3 is supplied in a Tris-based buffer with 50% glycerol, with working aliquots stable at 4°C for up to one week .

What assays can effectively measure LCL3 endonuclease activity?

Several complementary approaches can be employed to assess LCL3 activity:

  • Gel-Based Assays:

    • Substrate: Supercoiled plasmid DNA or synthetic oligonucleotides

    • Analysis: Agarose gel electrophoresis to detect conversion from supercoiled to nicked or linear forms

    • Quantification: Densitometric analysis of substrate and product bands

  • Fluorescence-Based Assays:

    • FRET substrates: Oligonucleotides with fluorophore-quencher pairs

    • Real-time monitoring: Increase in fluorescence upon substrate cleavage

    • High-throughput potential: Adaptable to microplate format for screening

  • Biochemical Parameter Optimization:

    • pH optimization: Test activity across pH range 5.0-9.0

    • Metal dependence: Screen divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)

    • Salt sensitivity: Evaluate activity in 0-500 mM NaCl/KCl

Similar approaches have been successfully employed with other endonucleases, such as the type III restriction endonucleases, where specific buffer conditions dramatically affect enzyme activity .

How can genetic manipulation techniques be applied to study LCL3 function in Z. rouxii?

Recent advances in Z. rouxii genetic tools enable sophisticated approaches to LCL3 functional analysis:

  • Gene Deletion Strategies:

    • Target disruption using dominant drug resistance markers (KanMX, ClonNAT)

    • Marker recycling via Cre-loxP system for creating multiple mutations

    • Phenotypic analysis of Δlcl3 mutants under various stress conditions

  • Expression Modulation:

    • Overexpression using episomal vectors with constitutive promoters

    • Conditional expression with regulatable promoters

    • Reporter fusion constructs for expression analysis

  • Protein Engineering:

    • Domain mapping through truncation analysis

    • Site-directed mutagenesis of predicted catalytic residues

    • Protein-protein interaction studies using two-hybrid or co-immunoprecipitation approaches

The recent development of plasmids carrying dominant drug resistance markers specifically for Z. rouxii enables these approaches even in prototrophic and industrially relevant strains that were previously difficult to manipulate .

What role might LCL3 play in Z. rouxii's stress tolerance mechanisms?

As a halotolerant and osmotolerant yeast, Z. rouxii employs sophisticated stress response mechanisms that might involve LCL3:

  • DNA Damage Response Hypothesis:

    • Osmotic and salt stress can cause DNA damage

    • LCL3 may function in specialized repair pathways similar to endonuclease III

    • Expression analysis could reveal upregulation under stress conditions

  • Genomic Stability Maintenance:

    • High-salt environments can affect DNA topology and replication

    • LCL3 might resolve unusual DNA structures or replication intermediates

    • Comparative genomic analysis between wild-type and Δlcl3 strains under stress could reveal mutation frequencies

  • Experimental Investigation Approach:

    • RNA-seq analysis of LCL3 expression under various stress conditions

    • ChIP-seq to identify genomic binding sites

    • Synthetic genetic arrays to identify genetic interactions with known stress response genes

Understanding these mechanisms could provide insights into Z. rouxii's remarkable ability to thrive in environments that are inhibitory to other yeasts, such as high-salt food preserves .

How can contradictory results in LCL3 research be systematically reconciled?

When contradictory findings emerge in LCL3 research, a methodical approach to reconciliation includes:

  • Strain-Specific Variation Analysis:

    • Compare LCL3 sequences across Z. rouxii strains (CBS 732, ATCC 42981, etc.)

    • Examine genetic background differences that might affect LCL3 function

    • Test LCL3 from multiple strains under identical conditions

  • Experimental Condition Standardization:

    • Develop a standardized activity assay protocol with defined:

      • Buffer composition and pH

      • Metal ion concentration and type

      • Temperature and incubation time

      • Substrate preparation method

  • Systematic Variable Testing:

    • Construct an experimental matrix varying one parameter at a time

    • Use statistical design of experiments (DoE) approaches

    • Perform inter-laboratory validation studies

This methodical approach follows principles used in resolving contradictory findings in other enzyme systems, such as the debates regarding nucleoside diphosphate kinase's role in uracil repair .

What biotechnological applications might emerge from LCL3 research?

Understanding LCL3 function could lead to several promising biotechnological applications:

  • Novel Molecular Biology Tools:

    • If LCL3 exhibits unique sequence or structure specificity, it could be developed as a new molecular biology reagent

    • Potential applications in DNA manipulation, similar to restriction endonucleases

    • Possibly engineerable for custom nucleic acid targeting

  • Enhanced Stress-Tolerant Strains:

    • Engineering Z. rouxii strains with optimized LCL3 expression for improved industrial performance

    • Development of heterologous expression systems for transferring stress tolerance to other organisms

    • Application in bioprocessing under challenging conditions

  • Food Fermentation Applications:

    • Optimization of Z. rouxii strains for specific fermentation processes

    • Control of nucleic acid metabolism during food production

    • Enhanced preservation capabilities in fermented foods

These applications would build upon Z. rouxii's already established value in food and industrial biotechnology sectors .

What bioinformatic approaches can advance understanding of LCL3 function?

Computational methods offer powerful tools for elucidating LCL3 function:

  • Structural Prediction and Analysis:

    • Homology modeling based on related endonucleases

    • Molecular dynamics simulations to predict substrate binding

    • Virtual screening for potential inhibitors or activators

  • Comparative Genomics:

    • Identification of LCL3 homologs across yeast species

    • Correlation with osmotolerance and halotolerance phenotypes

    • Phylogenetic analysis to trace evolutionary history

  • Systems Biology Integration:

    • Network analysis to position LCL3 within cellular pathways

    • Prediction of genetic interactions through correlation analysis

    • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

Bioinformatic approaches could help prioritize experimental hypotheses and provide context for understanding LCL3's role in Z. rouxii biology.

How can LCL3 research contribute to understanding Z. rouxii's genome stability mechanisms?

Investigating LCL3's role in genome maintenance could provide fundamental insights:

  • DNA Repair Pathway Analysis:

    • Determine if LCL3 functions similarly to endonuclease III in base excision repair

    • Analyze repair of specific DNA lesions in wild-type vs. Δlcl3 strains

    • Examine synthetic lethality with other DNA repair pathway components

  • Stress-Induced Mutagenesis:

    • Measure mutation rates under osmotic/salt stress in presence/absence of LCL3

    • Analyze mutation spectra to identify specific types of DNA damage

    • Determine if LCL3 protects against specific mutagenic processes

  • Methodological Approaches:

    • CRISPR-Cas9 genome editing to create precise LCL3 mutations

    • Next-generation sequencing to analyze genome-wide mutation patterns

    • Live-cell imaging to track LCL3 localization during DNA damage response

These investigations would connect with broader questions about how extremophilic organisms maintain genome integrity under challenging environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.