Zygosaccharomyces rouxii Probable endonuclease LCL3 (LCL3) is an enzyme derived from the yeast Zygosaccharomyces rouxii . Endonucleases are enzymes that cleave phosphodiester bonds within a nucleic acid chain . LCL3 is classified as a probable endonuclease, suggesting it is predicted to have endonuclease activity based on its sequence and structural similarity to known endonucleases .
Zygosaccharomyces rouxii is an osmotolerant yeast known for its ability to survive in high-sugar environments . It is relevant in food fermentation and spoilage due to its capacity to grow in high sugar and salt concentrations .
Recombinant LCL3 is produced using genetic engineering techniques, allowing for large-scale production and purification of the protein . Some properties include:
Source Organism: Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) also known as Candida mogii
Storage: Recommended storage at -20℃, with long-term storage at -20℃ or -80℃ to maintain stability
Storage Buffer: Supplied in Tris-based buffer with 50% glycerol, optimized for protein stability
Amino Acid Sequence: MGDNRNLPVTQPNSINFNVVILSIFFSGSFIGAWAFFNRFLKQYTKATEIPQNVFRKRWL FGKVTAVGDGDNFHFFHAPGGLIAGWGWLRPLPELNKSDPPISSSKVGSSVPIHRRIFDS IFGRNKTRTAYSNYFLGLPVPYKNKRNLPTISIRICGVDAPERAHFGNPAQPFSEEALIW LRHTLIGKCVWIKPLAVDQYNRCVAKVEYWTWTGWKNVSLEMVKQGLAVVYESKTSAEFD GEEDKYRFHEMAAKARRRGIWSQKQFETPGEYKRRI
While specific applications for recombinant LCL3 from Zygosaccharomyces rouxii are not detailed in the provided data, endonucleases, in general, have diverse applications:
Molecular Biology: Restriction endonucleases are used to cleave DNA at specific sites, which is essential for gene cloning, DNA mapping, and other molecular biology techniques .
Genetic Research: Restriction endonuclease analysis is used to study the transmission of microorganisms .
Biotechnology: Endonucleases can be employed in various biotechnological applications, including gene editing and development of diagnostic tools .
KEGG: zro:ZYRO0G08272g
STRING: 4956.XP_002498355.1
Zygosaccharomyces rouxii is a non-conventional yeast species characterized by its exceptional halotolerance, osmotolerance, petite negative phenotype, and weak Crabtree positive characteristics. These traits, combined with its strong fermentative vigor, make it particularly appealing for industrial and food applications. Z. rouxii has become increasingly attractive in food and industrial biotechnology, though its exploitation has historically been limited by challenges in genetic manipulation . The species is known for its ability to grow in high-salt and high-sugar environments, which makes it both a spoilage concern in food preservation and a potentially valuable industrial organism. Z. rouxii strain ATCC 2623/CBS 732 represents one of the well-characterized reference strains of this species .
Endonuclease LCL3 (UniProt accession: C5DZY8) is classified as a probable endonuclease encoded in the Z. rouxii genome. Its designation as an EC 3.1.-.- enzyme indicates it belongs to the hydrolase family that acts on ester bonds, specifically phosphoric diester bonds . Endonucleases typically cleave phosphodiester bonds within nucleic acid chains (as opposed to exonucleases, which remove terminal nucleotides). Based on comparative analysis with other endonucleases, LCL3 likely plays a role in DNA metabolism processes such as DNA repair, recombination, or restriction, though its precise function remains to be fully characterized experimentally.
Z. rouxii's unique physiological characteristics create a distinct cellular environment that potentially influences LCL3 function. The yeast's exceptional osmotolerance suggests it maintains specialized mechanisms for stabilizing cellular components under osmotic stress. These conditions may affect:
Enzyme structure and stability - high intracellular solute concentrations could influence protein folding and activity
DNA topology and accessibility - altered ionic conditions may change how LCL3 interacts with nucleic acid substrates
Regulatory networks - stress response pathways likely modulate LCL3 expression and activity
Similar to how endonuclease III enzymes respond to cellular conditions in other organisms, LCL3 activity may be regulated by Z. rouxii's specialized metabolism and stress response systems .
Comparative analysis of LCL3 with other endonucleases reveals important functional insights:
This comparison highlights the diversity of endonuclease mechanisms and suggests potential functional roles for LCL3 in Z. rouxii cellular processes.
Based on sequence analysis and comparison with characterized endonucleases, the catalytic mechanism of LCL3 likely involves:
Metal ion coordination - conserved acidic residues (Asp, Glu) probably coordinate Mg²⁺ or Mn²⁺ ions essential for phosphodiester bond hydrolysis
Nucleophilic attack - activated water molecule likely serves as the nucleophile for hydrolyzing phosphodiester bonds
Substrate recognition - specific amino acid motifs determine DNA sequence or structure specificity
Similar to how endonuclease III operates in DNA repair pathways, LCL3 may use conserved structural elements to recognize specific DNA substrates . The sequence "RICGVDAPER" contains motifs consistent with metal ion coordination in other endonucleases. Experimental validation through site-directed mutagenesis would be required to confirm these predictions.
Developing efficient expression systems for LCL3 requires careful consideration of multiple factors:
Host Selection:
Vector Design Elements:
Promoter selection: Strong inducible promoters (T7 for E. coli; GAL1 for yeast)
Affinity tags: N or C-terminal His6 or GST tags for purification
Fusion partners: MBP or SUMO to enhance solubility if needed
Optimization Strategy:
Codon optimization for the expression host
Temperature reduction during induction (16-25°C)
Supplementation with metal ions (Mg²⁺, Mn²⁺) if required for folding
For Z. rouxii expression specifically, recently developed centromeric and episomal vectors with dominant selection markers (KanMX and ClonNAT) provide valuable tools for homologous expression . These systems allow for expression under native regulatory elements or controlled promoters.
Successful purification and storage of LCL3 require careful attention to conditions that maintain enzymatic activity:
Purification Protocol:
Initial capture: Affinity chromatography based on fusion tag
Secondary purification: Ion exchange or size exclusion chromatography
Buffer optimization: Tris-based buffer systems (pH 7.5-8.5) with 100-200 mM NaCl
Stability Considerations:
Metal ion inclusion: Supplement buffers with 1-5 mM MgCl₂ or MnCl₂
Reducing agents: Add 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation
Protease inhibitors: Use complete inhibitor cocktails during early purification steps
Storage Conditions:
According to product specifications, commercially available recombinant LCL3 is supplied in a Tris-based buffer with 50% glycerol, with working aliquots stable at 4°C for up to one week .
Several complementary approaches can be employed to assess LCL3 activity:
Gel-Based Assays:
Substrate: Supercoiled plasmid DNA or synthetic oligonucleotides
Analysis: Agarose gel electrophoresis to detect conversion from supercoiled to nicked or linear forms
Quantification: Densitometric analysis of substrate and product bands
Fluorescence-Based Assays:
FRET substrates: Oligonucleotides with fluorophore-quencher pairs
Real-time monitoring: Increase in fluorescence upon substrate cleavage
High-throughput potential: Adaptable to microplate format for screening
Biochemical Parameter Optimization:
pH optimization: Test activity across pH range 5.0-9.0
Metal dependence: Screen divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)
Salt sensitivity: Evaluate activity in 0-500 mM NaCl/KCl
Similar approaches have been successfully employed with other endonucleases, such as the type III restriction endonucleases, where specific buffer conditions dramatically affect enzyme activity .
Recent advances in Z. rouxii genetic tools enable sophisticated approaches to LCL3 functional analysis:
Gene Deletion Strategies:
Expression Modulation:
Overexpression using episomal vectors with constitutive promoters
Conditional expression with regulatable promoters
Reporter fusion constructs for expression analysis
Protein Engineering:
Domain mapping through truncation analysis
Site-directed mutagenesis of predicted catalytic residues
Protein-protein interaction studies using two-hybrid or co-immunoprecipitation approaches
The recent development of plasmids carrying dominant drug resistance markers specifically for Z. rouxii enables these approaches even in prototrophic and industrially relevant strains that were previously difficult to manipulate .
As a halotolerant and osmotolerant yeast, Z. rouxii employs sophisticated stress response mechanisms that might involve LCL3:
DNA Damage Response Hypothesis:
Genomic Stability Maintenance:
High-salt environments can affect DNA topology and replication
LCL3 might resolve unusual DNA structures or replication intermediates
Comparative genomic analysis between wild-type and Δlcl3 strains under stress could reveal mutation frequencies
Experimental Investigation Approach:
RNA-seq analysis of LCL3 expression under various stress conditions
ChIP-seq to identify genomic binding sites
Synthetic genetic arrays to identify genetic interactions with known stress response genes
Understanding these mechanisms could provide insights into Z. rouxii's remarkable ability to thrive in environments that are inhibitory to other yeasts, such as high-salt food preserves .
When contradictory findings emerge in LCL3 research, a methodical approach to reconciliation includes:
Strain-Specific Variation Analysis:
Compare LCL3 sequences across Z. rouxii strains (CBS 732, ATCC 42981, etc.)
Examine genetic background differences that might affect LCL3 function
Test LCL3 from multiple strains under identical conditions
Experimental Condition Standardization:
Develop a standardized activity assay protocol with defined:
Buffer composition and pH
Metal ion concentration and type
Temperature and incubation time
Substrate preparation method
Systematic Variable Testing:
Construct an experimental matrix varying one parameter at a time
Use statistical design of experiments (DoE) approaches
Perform inter-laboratory validation studies
This methodical approach follows principles used in resolving contradictory findings in other enzyme systems, such as the debates regarding nucleoside diphosphate kinase's role in uracil repair .
Understanding LCL3 function could lead to several promising biotechnological applications:
Novel Molecular Biology Tools:
Enhanced Stress-Tolerant Strains:
Engineering Z. rouxii strains with optimized LCL3 expression for improved industrial performance
Development of heterologous expression systems for transferring stress tolerance to other organisms
Application in bioprocessing under challenging conditions
Food Fermentation Applications:
Optimization of Z. rouxii strains for specific fermentation processes
Control of nucleic acid metabolism during food production
Enhanced preservation capabilities in fermented foods
These applications would build upon Z. rouxii's already established value in food and industrial biotechnology sectors .
Computational methods offer powerful tools for elucidating LCL3 function:
Structural Prediction and Analysis:
Homology modeling based on related endonucleases
Molecular dynamics simulations to predict substrate binding
Virtual screening for potential inhibitors or activators
Comparative Genomics:
Identification of LCL3 homologs across yeast species
Correlation with osmotolerance and halotolerance phenotypes
Phylogenetic analysis to trace evolutionary history
Systems Biology Integration:
Network analysis to position LCL3 within cellular pathways
Prediction of genetic interactions through correlation analysis
Multi-omics data integration (transcriptomics, proteomics, metabolomics)
Bioinformatic approaches could help prioritize experimental hypotheses and provide context for understanding LCL3's role in Z. rouxii biology.
Investigating LCL3's role in genome maintenance could provide fundamental insights:
DNA Repair Pathway Analysis:
Stress-Induced Mutagenesis:
Measure mutation rates under osmotic/salt stress in presence/absence of LCL3
Analyze mutation spectra to identify specific types of DNA damage
Determine if LCL3 protects against specific mutagenic processes
Methodological Approaches:
CRISPR-Cas9 genome editing to create precise LCL3 mutations
Next-generation sequencing to analyze genome-wide mutation patterns
Live-cell imaging to track LCL3 localization during DNA damage response
These investigations would connect with broader questions about how extremophilic organisms maintain genome integrity under challenging environmental conditions.