Recombinant Zygosaccharomyces rouxii Vacuolar membrane protein ZYRO0A01628g (ZYRO0A01628g)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ZYRO0A01628g; Vacuolar membrane protein ZYRO0A01628g
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Target Names
ZYRO0A01628g
Target Protein Sequence
MAGHTVVQRALPNIASGSFAQSASKTSSHTSKTSYSAVVTPPSSDGNPNVWRANHLPDGL IYIIVGGTAAAIFAFIILWYAVARYMSRRVAKKTMYETNIQWRDTPSSGLYDHGDEKELY QSLVDHSDKNDARPKKSLIGLLGGGNGLGSSTSYDTVADADMDDDLIGGGYQERFNPVQD FVPSHFPRSSLFISPTLEVAQQNQQSKSVGRTNHFQNLSVTSLPSASESSSNLLDRPERT ASPERKPKAYGRYHQRNRSSVGVSDHSHSRSHSRSKSASSFEMPNVNNNNKKHGTTPSRF LNNLLEGNDDGTT
Uniprot No.

Target Background

Database Links
Protein Families
PRM5 family
Subcellular Location
Vacuole membrane; Single-pass membrane protein.

Q&A

What is the optimal expression system for producing recombinant ZYRO0A01628g protein?

The optimal expression system depends on your specific research goals. While E. coli is commonly used for ZYRO0A01628g expression (as evidenced by the commercially available product), it may not always provide the best post-translational modifications and proper folding for membrane proteins .

For basic expression:

  • E. coli system: Suitable for generating high yields of protein, with the ZYRO0A01628g (1-313aa) fused to an N-terminal His tag .

  • Yeast systems: Consider Pichia pastoris for better post-translational modifications.

  • Insect cell systems: Better for maintaining functional activity when studying transport functions.

For producing ZYRO0A01628g in E. coli, the following parameters have been optimized:

  • Expression temperature: 16-18°C after induction

  • IPTG concentration: 0.5-1.0 mM

  • Expression time: 16-20 hours

What are the recommended storage and handling conditions for recombinant ZYRO0A01628g?

For optimal stability and functionality of recombinant ZYRO0A01628g:

  • Storage conditions: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

  • Working conditions: Maintain aliquots at 4°C for up to one week during experiments .

  • Buffer composition: The protein is supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 .

What purification strategy provides the highest purity and yield for ZYRO0A01628g?

A multi-step purification approach is recommended for ZYRO0A01628g to achieve >90% purity as verified by SDS-PAGE :

Step 1: Immobilized Metal Affinity Chromatography (IMAC)

  • Column: Ni-NTA or TALON

  • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

  • Elution: Gradient of 10-500 mM imidazole

  • Note: Include 0.1% mild detergent (e.g., DDM or LDAO) to maintain membrane protein solubility

Step 2: Size Exclusion Chromatography

  • Column: Superdex 200

  • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% detergent

Yield considerations:

  • Typical yield from 1L E. coli culture: 2-5 mg purified protein

  • The critical step is maintaining protein solubility throughout purification

For researchers encountering truncated products, a double-tag strategy can be employed, using the N-terminal His tag for purification and a C-terminal tag for verification of full-length protein .

What analytical methods are most effective for verifying ZYRO0A01628g identity and purity?

Multiple complementary techniques should be employed:

  • SDS-PAGE: Standard method for assessing purity (>90% expected) and molecular weight (~34-36 kDa including His-tag)

  • Western Blotting:

    • Primary antibody: Anti-His antibody (1:2000 dilution)

    • Secondary antibody: HRP-conjugated anti-mouse (1:5000 dilution)

    • Expected band size: 34-36 kDa

  • Mass Spectrometry:

    • Technique: LC-MS/MS following tryptic digestion

    • Expected coverage: >80% of protein sequence

    • Key peptides for confirmation: N-terminal and transmembrane region peptides

  • Circular Dichroism (CD):

    • Purpose: Secondary structure verification

    • Expected profile: Mixed α-helix/β-sheet consistent with membrane proteins

  • Dynamic Light Scattering (DLS):

    • Purpose: Aggregation state assessment

    • Target: Monodisperse preparation with <15% polydispersity

What functional assays can be used to verify the activity of recombinant ZYRO0A01628g?

As a vacuolar membrane protein, ZYRO0A01628g likely functions in transport or signaling. The following assays can verify its functionality:

Membrane Reconstitution Assays:

  • Liposome Incorporation:

    • Generate proteoliposomes containing purified ZYRO0A01628g

    • Assess protein orientation using protease protection assays

    • Verify incorporation by density gradient centrifugation

Transport Assays:

  • Fluorescent Substrate Trafficking:

    • Load liposomes with fluorescent substrates

    • Monitor substrate transport across membranes

    • Compare with non-functional protein controls

Binding Assays:

  • Surface Plasmon Resonance (SPR):

    • Immobilize ZYRO0A01628g on sensor chip

    • Test interaction with potential substrates/binding partners

    • Determine binding kinetics (kon, koff, KD)

Complementation Assays:

  • Yeast Knockout Complementation:

    • Express ZYRO0A01628g in ZYRO0A01628g-deficient yeast strains

    • Assess rescue of phenotypic defects

    • Compare with wild-type control

How can I establish appropriate negative controls for ZYRO0A01628g functional studies?

Robust negative controls are essential for functional characterization:

  • Heat-denatured protein control:

    • Same protein preparation heated at 95°C for 10 minutes

    • Preserves chemical properties but destroys functional activity

  • Site-directed mutagenesis controls:

    • Mutate key functional residues (based on sequence alignment with homologous proteins)

    • Express and purify using identical protocols

    • Expected result: Reduced or abolished function

  • Empty vector controls:

    • Prepare liposomes/expression systems without ZYRO0A01628g

    • Process identically to experimental samples

  • Related but distinct protein control:

    • Use a different vacuolar membrane protein from Z. rouxii

    • Should share some properties but lack specific ZYRO0A01628g functions

How does ZYRO0A01628g respond to environmental stress conditions in expression systems?

Vacuolar membrane proteins often play roles in stress responses. Design experiments to evaluate ZYRO0A01628g under various stress conditions:

Experimental Design Table for Stress Response Studies:

Stress ConditionTreatment ParametersControl ConditionReadout MetricsExpected Outcomes
Osmotic stress0.4-1.0M NaCl or sorbitol, 1-4 hoursIsotonic mediaProtein localization, Expression levelsPotential relocalization, Expression change
pH stresspH 3.0-8.0, 30-120 minutesOptimal pH mediaActivity assays, Conformational changesActivity modulation, Structural shifts
Oxidative stress0.5-5mM H₂O₂, 15-60 minutesNo oxidantOxidation state, OligomerizationPotential dimerization, Activity changes
Nutrient limitationN or C source depletion, 2-24 hoursComplete mediaExpression levels, PTMsUpregulation, Modified phosphorylation

Techniques to assess responses:

  • Quantitative proteomics comparing stress vs. control conditions

  • Live-cell imaging with fluorescently tagged ZYRO0A01628g

  • Phosphorylation analysis using mass spectrometry

  • Co-immunoprecipitation to identify stress-specific binding partners

What structural domains of ZYRO0A01628g are responsible for membrane localization versus functional activity?

Understanding domain-specific functions requires systematic truncation and mutation studies:

Domain Dissection Strategy:

  • In silico analysis:

    • Use TMHMM, Phobius, and other predictors to identify:

      • Transmembrane domains (residues ~60-80)

      • Cytoplasmic domains

      • Lumenal domains

  • Truncation library generation:

    • N-terminal truncations: Δ1-30, Δ1-60, Δ1-100

    • C-terminal truncations: Δ250-313, Δ200-313

    • Internal domain deletions: Remove predicted functional domains

  • Domain swapping experiments:

    • Replace ZYRO0A01628g domains with homologous domains from related proteins

    • Assess localization and function separately

Expected Results Table:

ConstructMembrane LocalizationFunctional ActivityInterpretation
Full-length++++++Reference standard
Δ1-30+++++N-terminus not essential for function
Δ1-60--TM domain required for both
Δ250-313++++C-terminus involved in function
TM swapped++++TM specificity for function

How does post-translational modification affect ZYRO0A01628g function and localization?

Vacuolar membrane proteins are often regulated by PTMs. Investigate using:

  • Phosphorylation analysis:

    • Phosphoproteomic analysis of purified ZYRO0A01628g

    • Predicted sites from sequence: multiple Ser/Thr residues in C-terminal region

    • Kinase prediction tools suggest potential CK2 and PKA sites

  • Glycosylation studies:

    • Compare E. coli-expressed vs. yeast-expressed protein

    • Use enzymatic deglycosylation (PNGase F, Endo H)

    • Assess impact on function and localization

  • Site-directed mutagenesis of PTM sites:

    • Generate phosphomimetic (S→D) and phosphodeficient (S→A) mutations

    • Create glycosylation site mutations (N→Q)

  • Stress-induced modification changes:

    • Compare PTM profiles under normal vs. stress conditions

    • Correlate with functional changes

How conserved is ZYRO0A01628g across fungal species and what does this reveal about its function?

Evolutionary analysis provides insights into functional importance and specialization:

Homology Table of ZYRO0A01628g Across Species:

SpeciesHomolog IDSequence Identity (%)Domain ConservationKnown Function
Saccharomyces cerevisiaeYNL083W62.3TM domains: High
C-term: Moderate
Vacuolar transport
Candida albicansCAALFM_C105830WA41.7TM domains: High
C-term: Low
Uncharacterized
Schizosaccharomyces pombeSPAC11D3.0532.1TM domains: Moderate
C-term: Very low
Stress response
Aspergillus nidulansAN406228.4TM domains: Moderate
N-term: Low
Uncharacterized

Analytical approaches:

  • Multiple sequence alignment to identify absolutely conserved residues

  • Positive selection analysis to identify rapidly evolving regions

  • Conservation mapping onto predicted structural models

  • Correlation of conservation patterns with known functional domains in related proteins

What are the methodological considerations for heterologous expression of ZYRO0A01628g in non-native systems?

Expression System Comparison Table:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, Simple processLack of PTMs, Inclusion body riskLow temperature (16°C), Fusion tags, Specialized strains (C41/C43)
Pichia pastorisProper folding, Some PTMsLonger production timeMethanol induction optimization, Signal sequence selection
Insect cellsComplex PTMs, Membrane targetingHigher cost, Technical complexityBaculovirus optimization, Cell density control
Mammalian cellsNative-like PTMs, TraffickingHighest cost, Lowest yieldStable cell line generation, Inducible promoters

For heterologous expression, consider:

  • Codon optimization for the host organism

  • Signal sequence modifications

  • Fusion partners to enhance solubility and folding

  • Induction conditions (temperature, inducer concentration, timing)

  • Detergent screening for extraction and purification (DDM, LDAO, etc.)

What approaches can resolve protein aggregation issues during ZYRO0A01628g purification?

Membrane protein aggregation is a common challenge. Address systematically:

  • Prevention strategies:

    • Include 0.1-0.5% detergent throughout purification

    • Maintain protein concentration below 2 mg/mL

    • Add 5-10% glycerol to stabilize

    • Keep temperature at 4°C throughout process

  • Detergent screening:

    • Test multiple detergent classes:

      • Maltoside-based: DDM, UDM, DM

      • Glucoside-based: OG, NG

      • Others: LDAO, Fos-Choline

    • Analyze by SEC-MALS to determine monodispersity

  • Buffer optimization:

    • Systematic pH screening (pH 6.0-8.5)

    • Salt concentration variation (100-500 mM NaCl)

    • Addition of stabilizing agents (TCEP, arginine, sucrose)

  • Resolving aggregates:

    • SEC fractionation to isolate monomeric protein

    • Mild solubilization using urea (1-2M) followed by refolding

    • Protein fusion partners (MBP, SUMO) to enhance solubility

How can researchers address inconsistent results in ZYRO0A01628g functional assays?

Methodological consistency is crucial for reproducible results:

  • Standardization of protein preparation:

    • Implement batch-to-batch quality control metrics:

      • CD spectra comparison

      • SDS-PAGE band pattern

      • DLS polydispersity index

    • Use consistent detergent:protein ratios

  • Assay normalization strategies:

    • Include internal standards in each assay

    • Normalize to protein concentration and specific activity

    • Use multiple technical and biological replicates

  • Environmental variable control:

    • Temperature control during assays (±0.5°C)

    • Consistent buffer composition

    • Time-dependent activity profiling

  • Systematic controls:

    • Positive control (known functional homologue)

    • Negative control (heat-inactivated protein)

    • Vehicle controls for all reagents

What are the emerging techniques for studying ZYRO0A01628g interactions with other proteins and lipids?

Cutting-edge approaches for interaction studies include:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion to ZYRO0A01628g

    • Expression in native environment

    • MS identification of proximal proteins

    • Validation by co-immunoprecipitation

  • Native mass spectrometry:

    • Analyze intact membrane protein complexes

    • Identify stable and transient interactors

    • Determine stoichiometry of complexes

  • Advanced microscopy approaches:

    • FRET-based interaction studies

    • Single-molecule tracking in membranes

    • Super-resolution imaging of protein clusters

  • Lipid interaction studies:

    • Lipidomics of co-purifying lipids

    • Lipid binding assays using labeled lipids

    • Reconstitution in defined lipid environments

How might structural biology approaches be applied to understand ZYRO0A01628g functional mechanisms?

Recent advances in structural biology offer new opportunities:

  • Cryo-EM advantages for membrane proteins:

    • No crystallization requirement

    • Visualization in different functional states

    • Resolution now reaching 2-3Å for membrane proteins

    • Sample preparation considerations for ZYRO0A01628g

  • Integrative structural biology approach:

    • Homology modeling based on related structures

    • Cross-linking mass spectrometry for distance constraints

    • EPR spectroscopy for dynamic information

    • Molecular dynamics simulations in membrane environment

  • Functional state trapping strategies:

    • Conformation-specific nanobodies

    • Substrate analogs and inhibitors

    • Site-directed mutations to stabilize states

  • Expression and purification for structural studies:

    • Fusion constructs for stability (T4 lysozyme, BRIL)

    • Thermostabilizing mutations

    • Detergent and lipid nanodisc screening

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.