Recombinant Zygote defective protein 12 (zyg-12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag.
Synonyms
zyg-12; CBG02287; Zygote defective protein 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-764
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
zyg-12
Target Protein Sequence
MLDLTNQESDSSENGNSKYADSTDGRGIGTSRRLDDEDLDERRKDLADLVFWMSGLKATT LPLDDHTSLCNGRAFAEILHEIDRSFFDERWLETMPEMRTSSNLVVKRSNLRKLWRKMSD YIQVLNRKVVSTRWTEIGDRLDGLDETDIPVAADLAMAVVSLAFIGKTQEKYIQYSQELP AGEHQHMMANVARLVQIVMEELPEVPTFHEISELDGSQNELNSSHVESSVITNGNGSAER RSTLSANDQVLVEAQLEIDELRSERDNLIKDVERLTKALESSQLDTSTCSEPNELSILEK QNEELRVKRRQAEERVLELEASMEHFQAIVVKLTDENDTLQSGQKELNMLKTHLDTAQSD VEEWRTIANKYQSDAEMLKKREKEVKELQGQVKSLTSRLEHHVKTATIDEDNKAGIVQLR SQIGTLTANNVELNVGLESKKRIVEQLELQLIQYKEKVKELEDRKEDLIAERNELENKLL FKESVTPRSLHESMFEAGHLSFDDKTKLPLEIENKRLTERIQELESLEPLKGEIIKMKSQ NGVLEEEKLVITKQMEELERQVADLQEKLTKNQQHASGDVVELKVQLEKANVEVERMRET EMRTEAKLAGVEELLRKRNVEKEANETALQKAKAVIDELESRNRPVGEDNKTSVQDFKEL KTENELLRQKNEALETALNTTTQSLEQENRLITSAAHQQILDRSSDSMMIMRAQAGSDHP QTLLDTQKMTRALPWRFGISSMLIIFMVWFFINTFCEVNAPPKA
Uniprot No.

Target Background

Function
Zygote defective protein 12 (Zyg-12) is a cytoskeletal linker protein crucial for the attachment of the centrosome to the nucleus. It plays a vital role in ensuring the proper localization of dynein to the nuclear envelope.
Database Links

STRING: 6238.CBG02287

Protein Families
Hook family
Subcellular Location
Nucleus membrane. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton.

Q&A

What is zyg-12’s primary molecular role in meiotic regulation?

zyg-12 functions as a LINC complex component bridging the nuclear envelope to cytoplasmic dynein, enabling microtubule-dependent nuclear positioning. In C. elegans germline syncytia, zyg-12 recruits dynein (DHC-1) to maintain nuclear spacing: wild-type gonads show 92% nuclei at the periphery vs. 37% in zyg-12(ct350 ts) mutants . Methodological approaches include:

  • Live imaging with α-tubulin/GFP::ZYG-12 reporters to track nuclear migration defects

  • Allele-specific phenotyping: Compare ct350 (Q44P, disrupts ZYG-12–DLI-1 interaction) and or577 (Q367P, abolishes ZYG-12 homodimerization) using temperature-shift assays

  • Co-immunoprecipitation with SUN-1 to validate LINC complex integrity

Table 1: Phenotypic Outcomes of zyg-12 Alleles in C. elegans

AlleleNuclear Positioning DefectsCentrosome DetachmentFertilityKey Interaction Disrupted
ct350(ts)Severe (63% rachis invasion)100% embryos affectedLethalZYG-12–DLI-1
or577(ts)None89% embryos affectedViableZYG-12 homodimerization
Δex8+9NormalNormalViableEE localization
Data sources:

Which model systems are optimal for studying zyg-12 function?

Recommended systems:

  • C. elegans gonad syncytium: Enables visualization of nuclear positioning defects via immunofluorescence (anti-ZYG-12/DHC-1) and ultrastructural analysis (rachis invasion quantification)

  • Early embryos: Use 4D microscopy to track centrosome-NE attachment failures in ct350 mutants (92% detachment rate at 25°C)

  • Epidermal epithelia: Employ tissue-specific CRISPR-Cas9 knockouts (Δex8+9) to dissect EE trafficking roles

Validation workflow:

  • Confirm zyg-12 isoform expression via RT-PCR (isoforms A/B/C differ in exon 8–9 retention)

  • Perform rescue experiments with transgenic isoforms: Isoform C restores NE localization but not EE function in Δex8+9 mutants

How do zyg-12 isoforms achieve tissue-specific dynein recruitment?

zyg-12’s C-terminal alternative splicing dictates cargo specificity:

  • Isoform A (exons 1–7): Lacks transmembrane domain; binds FHIP-1/UBC-19 for EE trafficking

  • Isoform C (exons 1–9): Retains SUN-1-binding domain for NE anchoring

Methodological strategies:

  • Domain deletion mapping: Truncate zyg-12 after exon 7 (Δex8+9) to abolish NE targeting while preserving EE recruitment

  • Yeast two-hybrid screens: Identify FHF domain interactions (residues 150–300) with FHIP-1 (P = 1.2e-10)

  • Single-molecule imaging: Quantify dynein motility on EE vs. NE trajectories using TIRF microscopy

Table 2: Isoform-Specific Localization and Binding Partners

IsoformLocalizationKey PartnersFunctional Outcome
AEarly endosomesFHIP-1, UBC-19EE maturation (Rab5→Rab7 transition)
BNE + endosomesSUN-1, DLI-1Nuclear spacing + vesicle transport
CNuclear envelopeSUN-1, DHC-1Meiotic chromosome pairing
Data sources:

How to resolve contradictions in zyg-12’s role across developmental stages?

Discrepancies arise from differential isoform expression:

  • Embryonic lethality in ct350 reflects zyg-12’s mitotic role (centrosome-NE tethering)

  • Adult viability in Δex8+9 mutants indicates dispensability of EE-specific isoforms post-development

Experimental resolution:

  • Conduct stage-specific RNAi knockdowns: Deplete zyg-12 isoforms during L1 larval vs. adult stages

  • Use tissue-specific promoters (e.g., ajm-1 for epithelia, glh-1 for germline) to drive isoform expression

  • Perform methylation profiling in NLRP2 homologs to assess epigenetic compensation (see for imprinting links)

What genetic tools best characterize zyg-12–dynein interaction dynamics?

Key tools:

  • Bimolecular fluorescence complementation (BiFC): Tag zyg-12/DLI-1 with split YFP to map interaction sites (Q44P disrupts complementation efficiency by 78%)

  • FRAP (fluorescence recovery after photobleaching): Measure turnover rates of GFP::ZYG-12 at NE (t1/2 = 45s) vs. EE (t1/2 = 22s)

  • Crosslinking mass spectrometry: Identify contact residues between zyg-12’s Hook domain and DLI-1’s N-terminal lobe

Contradiction management:

  • Address false positives in yeast two-hybrid via orthogonal validation (e.g., in vitro pull-downs with purified isoforms)

  • Control for temperature-sensitive allele instability using parallel cultures at 15°C vs. 25°C

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.