Recombinant Zymomonas mobilis ATP synthase subunit a (atpB)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order. We will prepare the product according to your request.
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; ZMO0667; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Target Names
atpB
Target Protein Sequence
MAATNNVDPMHQFTVEPLHGLHIGKYDISFTNSALWMVIAMAALAIFMAGGRRKALIPGR
WQMAVEVMTRFVNDMVSTNIGPKGRPFTPLIFTLFMFILFANLLGLVPLFGFLPGAEPFT
STSHVTVTATLAAIAFGTVLVVGFTRHGLGFFKLFVPHGTPMALIWLIPGIEAFSFILRP
FSLALRLFVAMTAGHVLLEVLANFIVNPPVQSASPAFLAGYYTLVGIPTFLLMIGISALE
FLVCAIQAYVFALLTSLYLNDAINLH
Uniprot No.
Target Background
Function
This protein is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
KEGG: zmo:ZMO0667
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
