Recombinant Zymomonas mobilis Large-conductance mechanosensitive channel (mscL)

What is the basic structure of Zymomonas mobilis MscL protein?

The Zymomonas mobilis Large-conductance mechanosensitive channel (MscL) is a full-length protein consisting of 154 amino acids. The complete amino acid sequence is: MSILTDFKNFISKGNVLGLGIAVIMGDAFNKIISSVTGDLLMPIIGAVFGGVDFSGFFIRLGAVPAGYTGSLTSYNDLKKAGVPLFGYGQFLTVVVNFVIVAFILFMIMKLAAKLQKELDK TEAKKEEKIAEAAPTPEDIVLLREIRDELRGKK . The protein contains transmembrane domains that form a channel structure responsive to membrane tension. When expressed recombinantly, it is typically fused to an N-terminal His tag to facilitate purification .

How does the MscL channel function in mechanosensation?

MscL functions as a tension-sensitive channel that responds to physical force in the membrane. The structural data available for MscL reveals two conformational states: a non-conducting "closed" state and a non-conducting "expanded intermediate" state . When sufficient membrane tension is applied, the channel undergoes a conformational change that opens the pore, allowing solutes to pass through. This gating mechanism involves substantial structural rearrangements, including tilting and rotation of the transmembrane helices. These conformational changes have been studied using various techniques including coarse-grained molecular dynamics simulations combined with experimental restraints from EPR and FRET data .

What expression systems are optimal for recombinant Z. mobilis MscL production?

For recombinant production of Z. mobilis MscL, Escherichia coli expression systems have proven effective. The protein is typically expressed as a fusion construct with an N-terminal His tag to facilitate purification . The full-length protein (amino acids 1-154) can be successfully expressed in E. coli, yielding a functional recombinant protein. The expression conditions should be optimized to ensure proper folding and insertion into the membrane, as MscL is a membrane protein. Temperature, induction time, and inducer concentration are critical parameters that need optimization for maximum yield of functional protein .

What purification strategies yield the highest purity Z. mobilis MscL protein?

High-purity Z. mobilis MscL protein (>90% as determined by SDS-PAGE) can be achieved through a combination of purification techniques :

• Affinity chromatography: Using Ni-NTA or similar matrices to capture the His-tagged protein

• Size exclusion chromatography: To separate aggregates and impurities based on molecular size

• Ion exchange chromatography: As a polishing step if necessary

The purified protein is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For long-term storage, addition of 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended. The default final concentration of glycerol is often 50% .

How can researchers study the conformational changes in MscL during gating?

Multiple complementary approaches have been developed to study MscL conformational changes:

• EPR and FRET experiments: These techniques provide inter-subunit distances and solvent accessibility data that can be used as restraints in molecular dynamics simulations .

• Molecular Dynamics (MD) simulations: Coarse-grained (CG) MD simulations combined with experimental restraints allow researchers to model the gating behavior of MscL on longer timescales than possible with atomistic simulations. This approach addresses both the timescale and sampling issues associated with standard atomistic MD simulations .

• Cross-linking studies: Chemical cross-linking can capture different conformational states and has been applied successfully to various MscL homologs .

• Structural techniques: Crystallography has been used to determine MscL structures, although primarily for homologs like MtMscL rather than Z. mobilis MscL specifically .

What computational approaches can model Z. mobilis MscL gating mechanisms?

Computational modeling of MscL gating can overcome the limitations of experimental approaches in capturing the dynamic process of channel opening. Key computational approaches include:

• Coarse-grained molecular dynamics (CG MD): This approach groups several atoms into a single particle, reducing system size and allowing for longer simulation times. CG models like MARTINI have been successfully used to model MscL gating .

• Restrained simulations: Incorporating experimental restraints from EPR and FRET experiments into CG simulations guides the system through conformational space toward physiologically relevant states .

• Applied tension simulations: Simulations that incorporate membrane tension can induce gating transitions, though care must be taken to apply physiologically relevant tensions .

• Combined approach: The most successful strategy combines CG MD with experimental restraints, allowing researchers to induce gating without excessive tension and model the open pore structure consistently with experimental data .

How does MscL function relate to Z. mobilis adaptation to environmental stress?

Z. mobilis is known for its ability to produce ethanol with high efficiency and tolerate ethanol concentrations up to 16% (v/v) . The mechanosensitive channel MscL likely plays a role in this adaptation by helping the bacterium respond to osmotic stress and maintain cellular integrity during environmental fluctuations.

Under stress conditions, including ethanol exposure, Z. mobilis exhibits changes in gene expression profiles. While MscL specifically hasn't been directly linked to ethanol tolerance in the provided research, other stress response mechanisms such as small RNAs (sRNAs) have been shown to improve ethanol tolerance. For example, overexpression of specific sRNAs led to approximately twofold increase in relative growth rate in 7% ethanol (v/v) RMG-supplemented media .

The function of MscL should be considered within the broader context of Z. mobilis stress response systems, which involve multiple components working together to maintain cellular homeostasis under challenging environmental conditions.

What is the relationship between MscL and energy metabolism in Z. mobilis?

Z. mobilis is characterized by energy-uncoupled growth with rapid catabolism and inefficient energy conversion . While the direct relationship between MscL and energy metabolism hasn't been explicitly established in the provided research, it's worth considering potential connections:

• Membrane potential maintenance: MscL's role in maintaining membrane integrity during osmotic stress could indirectly affect energy metabolism by preserving the proton motive force.

• Metabolic flux integration: The charge balanced genome-scale metabolic model (iEM439) of Z. mobilis includes 439 genes, 692 metabolic reactions, and 658 metabolites . This model predicts differences in ethanol production under aerobic versus anaerobic conditions. The mechanosensitive channel could play a role in the cell's response to these different conditions.

• ATP utilization: Z. mobilis uses ATPase to pump out protons, which is associated with energy-uncoupled growth . MscL function may interact with this process, particularly under stress conditions.

How can Z. mobilis MscL be utilized in synthetic biology applications?

Z. mobilis MscL offers several potential applications in synthetic biology:

• Biosensor development: The mechanosensitive properties of MscL can be exploited to create tension-sensitive biosensors that respond to mechanical stimuli by allowing passage of reporter molecules.

• Controlled release systems: Engineered MscL variants could serve as controllable nanovalves for release of compounds in response to specific stimuli.

• Stress resistance engineering: Understanding MscL function could inform strategies to engineer increased stress resistance in production strains of Z. mobilis, potentially improving ethanol production under industrial conditions.

• Integration with metabolic engineering: Z. mobilis is increasingly used as a platform for metabolic engineering, with its genome-scale metabolic model (iEM439) providing a framework for rational strain design . MscL could be a target for modification to improve strain performance under process conditions.

What differences exist between Z. mobilis MscL and homologs from other bacterial species?

While specific comparative studies of Z. mobilis MscL versus other bacterial homologs aren't detailed in the provided research, some general comparisons can be made:

• Sequence comparison: The Z. mobilis MscL amino acid sequence can be compared to well-studied homologs like those from E. coli (EcMscL), M. tuberculosis (MtMscL), and S. aureus (SaMscL). Such comparisons would reveal conserved functional domains and species-specific variations.

• Structural differences: Various techniques including cross-linking, crystallography, SEC-MALS, AUC, and OCAM have been applied to study MscL from different species . These studies have revealed variations in oligomeric state and structural details between homologs.

• Functional adaptations: Different bacterial species inhabit diverse ecological niches and face varying environmental challenges. The Z. mobilis MscL may have evolved specific adaptations related to the organism's ethanol-producing lifestyle and associated stress conditions.

• Gating properties: Mechanosensitive channels from different species often exhibit variations in gating tension thresholds and kinetics. These differences reflect adaptations to the specific membrane properties and physiological requirements of each organism.

What are common challenges in working with recombinant Z. mobilis MscL and how can they be addressed?

Working with membrane proteins like MscL presents several challenges:

• Protein aggregation: MscL, being a membrane protein, is prone to aggregation during expression and purification.

  • Solution: Optimize detergent selection and concentration. Consider using mild detergents like DDM or LDAO. Addition of stabilizers like glycerol (5-50%) and trehalose (6%) can help maintain protein stability .

• Low expression yields: Membrane proteins often express poorly in heterologous systems.

  • Solution: Optimize expression conditions including temperature (often lower temperatures improve folding), inducer concentration, and expression time. Consider specialized E. coli strains designed for membrane protein expression.

• Protein inactivity after purification: Loss of function during purification process.

  • Solution: Minimize freeze-thaw cycles. Store working aliquots at 4°C for up to one week . For reconstitution, carefully follow protocols to reintroduce the protein into a lipid environment that mimics its native membrane.

• Difficulty in functional assays: Assessing MscL activity can be challenging.

  • Solution: Consider patch-clamp electrophysiology or fluorescence-based assays to monitor channel activity. Liposome-based assays can also be effective for measuring MscL-mediated release of encapsulated markers.

How can researchers verify the proper folding and functionality of recombinant Z. mobilis MscL?

Verifying proper folding and functionality of recombinant MscL requires multiple complementary approaches:

• SDS-PAGE analysis: While this confirms protein purity (>90% as recommended), it doesn't guarantee proper folding .

• Circular dichroism (CD) spectroscopy: This technique provides information about secondary structure content and can indicate whether the protein has folded with the expected α-helical content characteristic of MscL.

• Size exclusion chromatography: This can verify that the protein exists in the expected oligomeric state rather than forming aggregates.

• Reconstitution into liposomes: Functional MscL should properly insert into lipid bilayers when reconstituted into liposomes.

• Electrophysiological measurements: Patch-clamp recordings of MscL reconstituted into liposomes or inserted into planar lipid bilayers can directly demonstrate channel activity in response to membrane tension.

• Osmotic shock assays: These functional assays can test whether the channel responds to osmotic pressure changes as expected for a properly folded and functional MscL.

How does Z. mobilis MscL fit into genome-scale metabolic models of Z. mobilis?

Z. mobilis has been modeled using genome-scale metabolic networks, with a notable example being the charge balanced genome-scale metabolic model (iEM439) . While MscL specifically may not be directly incorporated into metabolic flux modeling, its function has implications for cellular physiology that can affect metabolic outputs:

• Stress response integration: MscL's role in osmotic stress response affects cellular energetics, which in turn influences metabolic fluxes. The iEM439 model includes 439 genes, 692 metabolic reactions, and 658 metabolites , providing a framework for understanding these interconnections.

• Aerobic vs. anaerobic metabolism: The metabolic model predicts differences in Z. mobilis growth under aerobic versus anaerobic conditions, with ethanol production decreased and production of other metabolites including acetate and acetoin increased under aerobic conditions . MscL function may vary under these different conditions.

• Energy coupling: Z. mobilis exhibits energy-uncoupled growth, where ATPase is used to pump out protons . The activity of mechanosensitive channels like MscL could potentially interact with this energy management system, particularly under stress conditions.

• Model refinement opportunities: Future iterations of genome-scale models could potentially incorporate mechanosensitive channel activities as constraints or regulatory elements that affect cellular energetics and metabolite transport.

What transcriptomic data exists regarding Z. mobilis MscL expression under different conditions?

While the search results don't provide specific transcriptomic data focusing on MscL expression in Z. mobilis, they do mention related transcriptomic studies that could provide context:

• SOS response induction: Transcriptomic analysis of Z. mobilis under SOS-induction revealed differential expression of genes involved in DNA replication, repair, and cell-cycle control. While MscL wasn't specifically mentioned, this study demonstrates how Z. mobilis responds transcriptionally to stress conditions .

• Oxygen exposure response: Multi-omic analysis of oxygen exposure in Z. mobilis ZM4 by Martien et al. showed that certain genes, such as ZMO1754 (acetaldehyde dehydrogenase), increased in both transcript and protein abundance upon oxygen exposure . Similar analyses could potentially reveal MscL expression patterns under various stresses.

• Ethanol stress response: While ethanol stress RNA-seq data wasn't available for Z. mobilis (only microarray transcriptomes), anaerobic and aerobic data have been collected to represent conditions of lower and higher ethanol, respectively . Such datasets could be mined for information on MscL expression patterns.

Future research opportunities exist to specifically examine MscL expression under various industrially relevant conditions, such as ethanol stress, lignocellulosic hydrolysate exposure, and osmotic challenges.