RFPL4A Antibody

What is RFPL4A and why is it significant in cancer research?

RFPL4A (Ret finger protein-like 4A) is an uncharacterized ubiquitin ligase that has been identified as a novel factor inducing G1 cell cycle retention and reduced sensitivity to chemotherapy. Research has demonstrated that RFPL4A is significantly up-regulated in G1-arrested cancer cells, particularly in colorectal cancer cell lines like HCT116. The significance lies in its potential as a therapeutic target - knockdown of RFPL4A expression causes cells to resume mitosis and increases their susceptibility to anti-cancer drugs both in vitro and in vivo. This suggests that combination therapy using RFPL4A inhibition and conventional chemotherapy may represent a promising therapeutic approach for treating refractory cancers .

What types of RFPL4A antibodies are available for research applications?

Researchers can access several types of RFPL4A antibodies with varying characteristics:

• Host species variation: Primarily rabbit polyclonal and mouse monoclonal antibodies

• Clonality options: Both polyclonal and monoclonal antibodies are available

• Target regions: Antibodies targeting different epitopes including:

  • AA 1-100 region

  • AA 101-200 region

  • Specific peptide sequences (e.g., "PDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIK")

• Conjugation varieties: Available as unconjugated or conjugated to various labels:

  • Fluorophores (AbBy Fluor® 350, 555, 594, 647)

  • Biotin

  • Enzymes like HRP

This diversity allows researchers to select antibodies optimized for specific applications and experimental designs.

How should RFPL4A antibodies be validated for studying chemoresistance mechanisms?

Comprehensive validation of RFPL4A antibodies for chemoresistance studies should follow this methodological framework:

• Baseline specificity validation:

  • Western blot analysis using lysates from multiple cell lines, confirming the expected 42 kDa band

  • Peptide competition assays to verify specificity - compare Western blots with and without blocking peptide

  • Testing in RFPL4A knockdown models using validated shRNA sequences (e.g., TRCN0000230973, TRCN0000230974)

• Functional validation in chemoresistance contexts:

  • Compare antibody detection in paired chemosensitive/resistant cell populations

  • Correlate antibody staining intensity with G1 arrest (using Fucci system as described in literature)

  • Quantitative analysis of RFPL4A expression in cells before and after chemotherapy exposure

• Technical validation parameters:

  • Test multiple antibodies targeting different epitopes to ensure consistent results

  • Establish optimal fixation and staining conditions for each cell line and tissue type

  • Include proper negative controls (isotype controls, secondary-only controls)

• Cross-methodology validation:

  • Confirm antibody results with orthogonal methods (mRNA quantification, reporter systems)

  • Correlate protein detection with biological effects (cell cycle arrest, chemotherapy resistance)

This validation approach ensures that findings related to RFPL4A and chemoresistance accurately reflect biological mechanisms rather than technical artifacts .

What methodological approach is recommended for studying RFPL4A's role in G1 phase retention?

Based on published research, the following integrated methodological approach is recommended for studying RFPL4A's role in G1 phase retention:

• Cell system selection and preparation:

  • Utilize Fucci (fluorescence ubiquitin-based cell cycle indicator) expressing cells as described in the literature, which allow visual identification of cell cycle phases

  • Establish stable cell lines with modulated RFPL4A expression:

    • Overexpression using retroviral vectors (pMX-RFPL4A as detailed in the literature)

    • Knockdown using validated shRNAs (sequences provided in Table 3 from research papers)

• Cell cycle analysis protocols:

  • Long-term time-lapse observation of Fucci-expressing cells to track G1 retention

  • Flow cytometry with PI staining for DNA content analysis

  • Immunofluorescence co-staining with RFPL4A antibody (1:400 dilution) and cell cycle markers

• RFPL4A expression correlation with G1 arrest:

  • Separate cell populations based on cell cycle phase (e.g., isolate red-fluorescing G1-arrested cells)

  • Quantify RFPL4A expression in different subpopulations using:

    • Western blot with anti-RFPL4A antibody (1:500 dilution)

    • Quantitative real-time PCR (using primers in Table 1 from literature)

  • Analyze intensity of RFPL4A immunostaining in individual cells and correlate with cell cycle phase

• Mechanism investigation:

  • Identify downstream targets of RFPL4A using antibody-based techniques

  • Examine effects of RFPL4A modulation on cell cycle regulators

  • Test combination of RFPL4A inhibition with cell cycle-targeting drugs

This approach provides comprehensive analysis of RFPL4A's functional role in regulating G1 phase retention and subsequent chemoresistance .

How can researchers optimize immunohistochemistry protocols for RFPL4A detection in different tissue types?

Optimizing immunohistochemistry protocols for RFPL4A detection requires systematic adjustment of multiple parameters:

• Antigen retrieval optimization:

  • Test different buffers with published success using Tris-EDTA, pH 9.0

  • Compare heat-induced epitope retrieval methods (microwave, pressure cooker, water bath)

  • Optimize retrieval duration and temperature

• Antibody selection and concentration titration:

  • Test polyclonal and monoclonal options with recommended starting dilutions:

    • 1:50-1:200 for paraffin sections

    • 1-4 μg/ml for immunofluorescence applications

  • Prepare serial dilutions to determine optimal signal-to-noise ratio

  • Include positive control tissues (colon cancer samples have shown positive staining)

• Detection system optimization:

  • Compare detection methods (HRP-DAB, AP-Red, fluorescence)

  • Optimize secondary antibody conditions (1:200 dilution for 45 minutes at room temperature has been validated)

  • Test signal amplification methods for tissues with low expression

• Tissue-specific modifications:

  • Adjust fixation protocols based on tissue type

  • Modify blocking procedures to reduce background in specific tissues

  • Consider multiplex staining with cell cycle markers to correlate with RFPL4A expression

• Validation controls:

  • Include peptide competition controls to confirm specificity

  • Use RFPL4A-overexpressing and knockdown samples as controls

  • Implement standardized scoring systems for consistent interpretation

This systematic optimization approach ensures reliable detection of RFPL4A across different tissue types while minimizing variability and non-specific staining .

How should researchers interpret different staining patterns of RFPL4A in cancer tissues?

When interpreting RFPL4A staining patterns in cancer tissues, researchers should consider multiple factors:

• Subcellular localization interpretation:

  • RFPL4A may localize to both cytoplasm and nucleus based on GO annotations

  • Different subcellular patterns may indicate different functional states

  • Document the predominant localization pattern and any heterogeneity

• Intensity and distribution analysis:

  • Quantify staining intensity using standardized scales (0-3+ or H-score methods)

  • Analyze percentage of positive cells (research has used ROC curve analysis with optimal cut-off values)

  • Document heterogeneity within samples (research found 70% of G1-retained cells showed high RFPL4A expression)

• Correlation with biological contexts:

  • Relate RFPL4A expression to proliferation status (Ki-67) and cell cycle markers

  • Compare expression in tumor vs. adjacent normal tissue

  • Correlate with patient treatment history and response to therapy

• Common staining patterns and interpretations:

  • Strong nuclear staining: May indicate active involvement in transcriptional regulation

  • Cytoplasmic staining: May reflect protein synthesis or interaction with cytoplasmic substrates

  • Heterogeneous expression: May identify subpopulations with different cell cycle characteristics

• Technical considerations:

  • Validate findings using multiple antibodies targeting different epitopes

  • Confirm specificity through peptide blocking experiments

  • Consider artifacts from edge effects, necrotic areas, or poor fixation

Understanding these interpretation guidelines helps researchers extract meaningful biological insights from RFPL4A staining patterns in cancer tissues while avoiding technical artifacts .

What are common troubleshooting steps for weak or non-specific RFPL4A antibody signal?

When encountering weak or non-specific RFPL4A antibody signals, researchers should implement this systematic troubleshooting approach:

• For weak signal issues:

  • Antibody concentration adjustment:

    • Increase antibody concentration (try 2-5× the recommended dilution)

    • Extend primary antibody incubation time (overnight at 4°C instead of 1-2 hours)

  • Antigen retrieval enhancement:

    • Optimize buffer (Tris-EDTA pH 9.0 has been successful)

    • Extend retrieval time or increase temperature

  • Detection system amplification:

    • Switch to more sensitive detection methods (TSA amplification, polymer-based systems)

    • Use a different fluorophore with higher quantum yield for immunofluorescence

  • Sample preparation improvements:

    • Minimize fixation time to prevent epitope masking

    • Use freshly prepared samples when possible

• For non-specific signal issues:

  • Background reduction strategies:

    • Increase blocking time and concentration (3-5% BSA or normal serum)

    • Add detergent (0.1-0.3% Triton X-100) to reduce hydrophobic interactions

    • Include protein-based blockers in antibody diluent

  • Antibody validation:

    • Test antibody specificity using peptide competition assays

    • Compare results with multiple antibodies targeting different epitopes

    • Use RFPL4A knockdown controls (with validated shRNAs from Table 3)

  • Washing optimization:

    • Increase washing duration and number of wash steps

    • Add salt to wash buffer (up to 500mM NaCl) to reduce ionic interactions

• Protocol modification strategies:

  • Test fixation methods (paraformaldehyde vs. methanol)

  • Adjust permeabilization conditions

  • Consider using recombinant antibody technology for improved consistency

Implementing these troubleshooting steps systematically can help researchers improve RFPL4A detection while maintaining specificity .

How do you differentiate true RFPL4A expression changes from technical variability in Western blots?

Differentiating true RFPL4A expression changes from technical variability in Western blots requires rigorous controls and analysis:

• Essential loading and technical controls:

  • Use validated housekeeping proteins (β-actin has been used at 1:1000 dilution)

  • Include molecular weight markers to confirm the expected 42kDa band for RFPL4A

  • Run positive controls (RFPL4A-overexpressing cells) and negative controls (knockdown samples)

  • Prepare technical replicates to assess reproducibility

• Sample preparation standardization:

  • Use consistent lysis buffers and protein extraction protocols

  • Measure protein concentration with reliable methods (BCA or Bradford assay)

  • Load equal amounts of protein (validate with total protein staining methods)

  • Process all experimental and control samples simultaneously

• Antibody validation approaches:

  • Perform peptide competition assays (pre-incubate antibody with immunizing peptide)

  • Test specificity through Western blots of HeLa and HUVEC cells (validated cell lines)

  • Use multiple antibodies targeting different RFPL4A epitopes

  • Include isotype control antibodies at equivalent concentrations

• Quantification methods:

  • Use digital image analysis software for densitometry

  • Normalize RFPL4A signal to loading controls

  • Apply statistical analysis to determine significance of observed changes

  • Present data from multiple biological replicates (minimum n=3)

• Experimental design considerations:

  • Include dose-response or time-course elements to establish trends

  • Correlate protein changes with mRNA expression (using validated primers from Table 1)

  • Compare Western blot results with immunofluorescence or flow cytometry data

  • Document experimental conditions that might affect expression (cell density, passage number)

This comprehensive approach helps researchers distinguish genuine biological changes in RFPL4A expression from technical artifacts .

How can RFPL4A antibodies be used to investigate chemotherapy resistance mechanisms?

RFPL4A antibodies can be strategically employed to investigate chemotherapy resistance mechanisms through this multifaceted approach:

• Identification of resistant cell populations:

  • Use RFPL4A antibody staining to identify and isolate high-expressing cells

  • Correlate RFPL4A expression with G1 arrest using the Fucci system

  • Perform cell sorting based on RFPL4A expression levels followed by drug sensitivity testing

  • Conduct immunohistochemistry on patient samples before and after chemotherapy treatment

• Mechanistic investigation protocols:

  • Immunoprecipitation with RFPL4A antibodies to identify interaction partners

  • Examine ubiquitination targets of RFPL4A using antibody pulldowns followed by mass spectrometry

  • Perform ChIP assays if RFPL4A is suspected to influence transcriptional regulation

  • Study subcellular localization changes following drug treatment using immunofluorescence

• Therapeutic intervention assessment:

  • Monitor RFPL4A expression changes during development of drug resistance

  • Test combination therapy approaches:

    • siRNA knockdown of RFPL4A using validated sequences with atelocollagen delivery

    • Standard chemotherapy agents (e.g., 5-FU 30 mg/kg/day as used in published studies)

  • Evaluate reversion of resistance following RFPL4A inhibition

• Translational research applications:

  • Develop tissue microarray analysis with RFPL4A antibodies to screen patient samples

  • Correlate RFPL4A expression with clinical outcomes and treatment response

  • Investigate RFPL4A as a biomarker for therapy selection

This methodological framework leverages RFPL4A antibodies to comprehensively investigate the mechanisms by which RFPL4A contributes to chemotherapy resistance, potentially leading to improved therapeutic strategies .

What experimental approach is recommended for studying RFPL4A's E3 ubiquitin ligase activity?

For studying RFPL4A's E3 ubiquitin ligase activity, the following comprehensive experimental approach is recommended:

• Protein domain analysis and antibody selection:

  • Select antibodies targeting non-functional domains to avoid interference with ubiquitin ligase activity

  • Use antibodies recognizing the RING finger domain for specific studies of the catalytic region

  • Consider structural epitopes within the RFPL4A sequence ("MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRALVSIIKELEPKLKSVLTMNPRMRKFQVDMTF")

• In vitro ubiquitination assays:

  • Immunoprecipitate RFPL4A using validated antibodies

  • Perform in vitro ubiquitination assays with:

    • Purified E1 and E2 enzymes

    • Ubiquitin (consider tagged versions for easier detection)

    • ATP and buffer components

  • Detect ubiquitination using anti-ubiquitin antibodies in Western blots

• Substrate identification approaches:

  • Immunoprecipitation with RFPL4A antibodies followed by mass spectrometry

  • Compare ubiquitination patterns in control vs. RFPL4A-overexpressing cells

  • Perform proximity ligation assays to detect RFPL4A interactions with potential substrates

  • Validate identified substrates through in vitro and in vivo approaches

• Structure-function analysis:

  • Use antibodies recognizing different domains to assess domain-specific functions

  • Analyze truncated RFPL4A variants lacking catalytic domains

  • Examine RFPL4A auto-ubiquitination as a measure of enzymatic activity

  • Correlate E3 ligase activity with G1 arrest phenotype

• Cell-based validation systems:

  • Generate cells expressing RFPL4A with mutations in the RING domain

  • Use reporter systems for ubiquitination activity

  • Compare cell cycle effects of wild-type vs. ligase-dead RFPL4A

  • Examine effects of proteasome inhibitors on RFPL4A-mediated phenotypes

This experimental framework enables comprehensive characterization of RFPL4A's E3 ubiquitin ligase activity and its relationship to cell cycle regulation and chemoresistance .

How can RFPL4A antibodies be incorporated into multiparameter flow cytometry for cell cycle analysis?

RFPL4A antibodies can be effectively incorporated into multiparameter flow cytometry for cell cycle analysis through this detailed methodological approach:

• Sample preparation optimization:

  • Harvest cells during exponential growth phase

  • Fix with 2-4% paraformaldehyde (10 minutes at room temperature)

  • Permeabilize with 0.1% Triton X-100 or 90% methanol

  • Include RFPL4A-overexpressing and knockdown controls

• Antibody staining protocol:

  • Block with 3-5% BSA or normal serum

  • Stain with primary RFPL4A antibody (starting dilution 1:100-1:500)

  • If using unconjugated primary antibody, add appropriate fluorochrome-conjugated secondary antibody

  • Consider directly conjugated RFPL4A antibodies for reduced background and simplified protocols

    • Available conjugations include fluorophores like AbBy Fluor® 350, 555, 594, 647

• Multiparameter panel design:

  • DNA content staining: DAPI or propidium iodide (following RNase treatment)

  • Cell cycle markers:

    • Ki-67 (proliferation marker)

    • Cyclins (D1 for G1, A for S, Cyclin B1 for G2/M)

  • Additional parameters:

    • Phospho-Rb for G1 checkpoint analysis

    • γH2AX for DNA damage assessment

    • Cleaved caspase-3 for apoptosis detection

  • Alternative approach: Use cells expressing the Fucci system as described in literature

• Instrument setup and data acquisition:

  • Perform proper compensation for spectral overlap

  • Include single-stained controls for each fluorochrome

  • Collect minimum 20,000 events per sample

  • Use consistent PMT voltages across experiments

• Analysis strategies:

  • Gate on single cells using FSC-H vs. FSC-A

  • Identify cell cycle phases based on DNA content

  • Create bivariate plots of RFPL4A vs. DNA content

  • Quantify RFPL4A expression within each cell cycle phase

  • Perform correlation analysis between RFPL4A levels and G1 distribution

• Validation and extension:

  • Sort RFPL4A-high and RFPL4A-low populations for functional testing

  • Confirm resistance phenotype in sorted populations using drug sensitivity assays

  • Validate flow cytometry findings with imaging cytometry or immunofluorescence microscopy

This comprehensive approach enables detailed characterization of RFPL4A expression in relation to cell cycle dynamics and chemoresistance mechanisms .