RGL3 Antibody

What is RGL3 and what is its biological function in plant systems?

RGL3 (RGA-LIKE3) belongs to the DELLA protein family, which acts as negative regulators of gibberellin (GA) signaling in plants. In Arabidopsis thaliana, the DELLA family consists of five members with overlapping yet distinct functions in repressing GA responses . What distinguishes RGL3 from other DELLA proteins is its essential role in enhancing jasmonate (JA)-mediated responses. RGL3 has shown functional diversification within the DELLA family by serving as an integrating factor linking GA and JA signaling pathways .

Methodologically, researchers investigating RGL3 function should consider:

• Using both loss-of-function mutants (rgl3-5) and overexpression lines to assess phenotypic effects

• Conducting hormone treatment assays with GA and JA to observe expression changes

• Implementing time-course studies, as RGL3 shows maximum induction after 1 hour of JA treatment

• Performing pathogen resistance assays, as RGL3 positively regulates JA-mediated resistance to necrotrophs like Botrytis cinerea but increases susceptibility to hemibiotrophs like Pseudomonas syringae

How should researchers select between commercially available RGL3 antibodies for their experimental needs?

When selecting an RGL3 antibody, researchers should consider several critical parameters to ensure experimental success:

• Antibody specificity: Validate that the antibody recognizes specifically RGL3 and not other DELLA family members. The Sigma-Aldrich RGL3 antibody (HPA043615) has been validated through recombinant expression techniques and is suitable for human RGL3 detection .

• Application compatibility: Different experimental applications require antibodies optimized for specific techniques. For example, the HPA043615 antibody is validated for:

  • Immunoblotting at concentrations of 0.04-0.4 μg/mL

  • Immunohistochemistry at dilutions of 1:20-1:50

• Species reactivity: Confirm that the antibody recognizes RGL3 from your study organism. The commercial antibody HPA043615 is specifically reactive to human RGL3 , whereas plant research would require antibodies raised against plant RGL3.

• Recognition region: For plant RGL3 studies, consider whether the antibody recognizes conserved or variable regions of the protein. For detecting RGL3-GFP fusion proteins, anti-GFP antibodies have been successfully used in previous studies .

What techniques are most effective for detecting and quantifying RGL3 protein in experimental samples?

For optimal detection and quantification of RGL3 protein, researchers should consider these methodological approaches:

Immunoblotting (Western blot):

• Effective for quantifying total RGL3 protein levels and detecting post-translational modifications

• For plant samples, RGL3-GFP fusion proteins can be detected using anti-GFP antibodies, as demonstrated in previous studies

• When using commercial antibodies like HPA043615, follow the manufacturer's recommended concentration (0.04-0.4 μg/mL)

Immunohistochemistry:

• Allows visualization of RGL3 subcellular localization in tissue sections

• Typical dilutions range from 1:20-1:50 for commercial antibodies like HPA043615

• Include appropriate negative controls to confirm specificity

Fluorescent protein fusions:

• RGL3-GFP translational fusions under the control of the native RGL3 promoter provide a powerful tool for visualizing protein dynamics

• This approach has been successfully used to demonstrate that JA treatment rapidly enhances the accumulation of RGL3-GFP protein

Co-immunoprecipitation:

• Essential for studying protein-protein interactions of RGL3 with partners like JAZ proteins or transcription factors

• Can be combined with mass spectrometry to identify novel interaction partners

How does RGL3 function within the jasmonate signaling network and what experimental approaches best capture this relationship?

RGL3 functions as a key mediator in the jasmonate (JA) signaling pathway through a multilayered regulatory mechanism:

Induction by JA signaling:

• JA rapidly induces RGL3 expression in a CORONATINE INSENSITIVE1 (COI1) and JASMONATE INSENSITIVE1 (JIN1/MYC2)-dependent manner

• Expression studies reveal that RGL3 reaches maximum induction approximately 1 hour after JA treatment

• The induction of RGL3 appears to be specific, as other DELLA proteins show minimal response to JA treatment

Direct regulation by MYC transcription factors:

• Chromatin immunoprecipitation (ChIP) assays demonstrate that MYC2 directly binds to the F3 region of the RGL3 promoter

• Electrophoretic mobility shift assays (EMSA) confirm that MBP-MYC2 fusion proteins specifically bind to DNA probes containing the CACATG G-box-like motif in the RGL3 promoter

• The regulation of RGL3 involves redundant function of MYC proteins, as JA-mediated induction is completely impaired only in the triple myc2 myc3 myc4 mutant

Experimental approaches for studying RGL3-JA relationships:

• Hormone treatment time courses - Apply JA (commonly 50-100 μM) and collect samples at multiple time points (0, 0.5, 1, 3, 6, 12, 24 hours) to track RGL3 expression dynamics

• qRT-PCR analysis - Quantify RGL3 transcript levels in wild-type vs. JA signaling mutants (coi1-1, myc2/jin1-8, myc3, myc4, and combination mutants)

• Protein stability assays - Monitor RGL3-GFP protein accumulation following JA treatment with or without GA co-treatment

• ChIP-qPCR - Use MYC2-FLAG transgenic lines to assess direct binding to the RGL3 promoter

• Transcriptome analysis - Compare JA-responsive gene expression in wild-type, rgl3 mutant, and RGL3 overexpression lines

What role does RGL3 play in plant defense responses and how can researchers effectively study this function?

RGL3 serves as a critical regulator of plant immunity through its integration of hormonal signaling pathways:

Pathogen-specific immune responses:

• RGL3 positively regulates JA-mediated resistance to necrotrophic pathogens like Botrytis cinerea

• Conversely, RGL3 promotes susceptibility to hemibiotrophic pathogens like Pseudomonas syringae

• This dual role highlights RGL3's function at the crossroads of different defense response pathways

Molecular mechanism:

• JA induces RGL3 expression through the COI1-JAZ-MYC2 signaling module

• Accumulated RGL3 protein interacts with JAZ repressors, which may sequester them and release MYC2 from inhibition

• This creates a positive feedback loop that amplifies JA responses

Experimental approaches for studying RGL3 in plant immunity:

• Pathogen infection assays:

  • Compare disease progression in wild-type, rgl3 mutant, and RGL3 overexpression lines

  • Measure infection parameters (lesion size, bacterial titer, fungal biomass) at multiple time points

  • Use both necrotrophic (Botrytis cinerea) and hemibiotrophic (Pseudomonas syringae) pathogens

• Defense marker gene expression:

  • Analyze JA-responsive defense gene expression patterns by qRT-PCR

  • Include established markers for different defense pathways (JA, SA, ET)

  • Compare expression in mock vs. pathogen-treated samples across genotypes

• Hormone cross-talk experiments:

  • Apply combinations of defense hormones (JA, SA, ET) and assess RGL3 expression

  • Measure defense gene expression in hormone-treated rgl3 mutants and RGL3 overexpression lines

  • Analyze genetic interactions using double mutants with components of multiple hormone pathways

What are the critical considerations for validating RGL3 antibody specificity before use in plant or human research?

Proper validation of RGL3 antibodies is essential to ensure experimental rigor and reproducibility:

Validation strategies for plant RGL3 antibodies:

• Genetic controls:

  • Test antibody reactivity against samples from rgl3 knockout mutants (negative control)

  • Compare signal with RGL3 overexpression lines (positive control)

  • Assess cross-reactivity with other DELLA family members using della pentuple mutants complemented with individual DELLA genes

• Protein expression patterns:

  • Verify that detected protein levels correlate with known expression patterns

  • Confirm JA-induced upregulation of RGL3 protein

  • Validate GA-mediated degradation of RGL3 protein

• Tag-based validation:

  • Compare detection using anti-RGL3 antibody versus anti-tag antibody in plants expressing epitope-tagged RGL3

  • Commonly used tags include GFP, HA, FLAG, or MYC

  • RGL3-GFP translational fusions have been successfully used in previous studies

Validation strategies for human RGL3 antibodies:

• Recombinant expression validation:

  • The commercial antibody HPA043615 has been validated through recombinant expression methods

  • Test against cell lines with RGL3 knockdown/knockout or overexpression

• Epitope analysis:

  • Verify recognition of the immunogen sequence (e.g., "VEIKKTAVQDLSFNKNLRAVVSVLGSWLQDHPQDFRDHPAHSDLGSVRTFLGWAAPGSAEAQKAEKLLED" for HPA043615)

  • Test reactivity against synthesized peptide fragments

• Application-specific validation:

  • For immunoblotting: Confirm single band of expected molecular weight

  • For immunohistochemistry: Verify expected subcellular localization and tissue distribution

What molecular mechanisms underlie RGL3 interactions with JAZ proteins and how can these be experimentally characterized?

The interaction between RGL3 and JAZ proteins represents a critical node in hormone cross-talk networks:

Molecular basis of RGL3-JAZ interactions:

• RGL3, like other DELLA proteins, directly interacts with JAZ proteins, which are key repressors of JA signaling

• This interaction creates a competitive mechanism where RGL3 can sequester JAZ proteins, thereby releasing MYC2 from JAZ-mediated repression

• The JA-induced accumulation of RGL3 thus creates a positive feedback loop in JA signaling

Experimental approaches for characterizing these interactions:

• In vitro protein-protein interaction assays:

  • Yeast two-hybrid (Y2H) screening to identify specific JAZ proteins that interact with RGL3

  • In vitro pull-down assays using recombinant proteins to confirm direct interactions

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine binding kinetics and affinity

• In vivo interaction studies:

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in plant cells

  • Co-immunoprecipitation (Co-IP) experiments from plant extracts using epitope-tagged proteins

  • Förster resonance energy transfer (FRET) to detect direct protein interactions in living cells

• Domain mapping experiments:

  • Generate truncated versions of RGL3 and JAZ proteins to identify minimal interaction domains

  • Perform site-directed mutagenesis of key residues to disrupt specific interactions

  • Compare interaction patterns across different DELLA and JAZ family members

• Competition assays:

  • Investigate whether RGL3-JAZ interactions compete with MYC2-JAZ interactions

  • Test if JA treatment affects the strength of RGL3-JAZ interactions

  • Examine how GA-induced degradation of RGL3 influences JAZ availability

What are the latest findings regarding RGL3's role in seed development and storage protein accumulation?

Recent research has unveiled a novel role for RGL3 in regulating seed storage protein accumulation:

RGL3-ABI3 regulatory module:

• RGL3 interacts with ABSCISIC ACID INSENSITIVE3 (ABI3), a critical transcription factor governing seed storage protein (SSP) accumulation

• This interaction occurs both in vivo and in vitro, with RGL3 greatly enhancing the transcriptional activating ability of ABI3 on SSP genes

• Genetic evidence demonstrates that RGL3 and ABI3 regulate SSP accumulation in an interdependent manner

Transcriptional regulation of seed storage proteins:

• GA treatment reduces the transcript levels of several SSP genes, including 2S1, 2S2, 2S3, CRA, CRB, and CRU3, suggesting that GA regulates SSP primarily at the transcriptional level

• As DELLA proteins (including RGL3) are destabilized by GA, this suggests that RGL3 may normally promote SSP gene expression

• The RGL3-ABI3 interaction represents a point of convergence between GA and ABA signaling pathways during seed development

Experimental approaches for studying RGL3 in seed development:

• Seed proteome analysis:

  • Compare protein profiles in mature seeds of wild-type, rgl3 mutants, and RGL3 overexpression lines

  • Quantify major seed storage proteins using mass spectrometry-based approaches

  • Analyze changes in the seed metabolome that may result from altered SSP accumulation

• Transcriptome analysis:

  • Perform RNA-seq during seed maturation in different genetic backgrounds

  • Identify genes co-regulated with SSPs that depend on RGL3 function

  • Analyze promoter elements of RGL3-dependent genes for common regulatory motifs

• Chromatin immunoprecipitation approaches:

  • Determine if RGL3-ABI3 complexes directly bind to SSP gene promoters

  • Map genome-wide binding sites of RGL3 and ABI3 during seed development

  • Analyze chromatin modifications at SSP loci dependent on RGL3 function

How can researchers design comprehensive experiments to dissect the regulatory network involving RGL3, phytohormones, and transcription factors?

To fully characterize the complex regulatory networks involving RGL3, researchers should implement multifaceted experimental strategies:

Integrative experimental design approaches:

• Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data from rgl3 mutants and RGL3 overexpression lines

  • Perform analyses under various hormone treatments (GA, JA, ABA) and during different developmental stages

  • Use network inference algorithms to identify key nodes and edges in the RGL3 regulatory network

• Temporal and spatial resolution:

  • Use inducible expression systems to control timing of RGL3 expression

  • Employ tissue-specific promoters to express RGL3 in defined cell types

  • Utilize single-cell RNA-seq to identify cell-specific responses to RGL3 modulation

• Protein complex characterization:

  • Perform tandem affinity purification followed by mass spectrometry (TAP-MS) to identify RGL3 protein complexes under different conditions

  • Use proximity labeling approaches (BioID, TurboID) to identify transient interaction partners

  • Implement protein-fragment complementation assays to validate specific interactions in vivo

Experimental workflow for dissecting RGL3 regulatory networks:

• Step 1: Define the baseline regulatory landscape

  • Generate transcriptome data from wild-type, rgl3 mutant, and RGL3 overexpression lines

  • Identify direct targets using ChIP-seq (if antibody quality permits) or DAP-seq

  • Integrate with publicly available transcription factor binding datasets

• Step 2: Map hormone response dynamics

  • Perform time-course analyses following hormone treatments

  • Compare wild-type and mutant responses to identify RGL3-dependent processes

  • Use pharmacological inhibitors to distinguish primary from secondary effects

• Step 3: Characterize protein interaction networks

  • Identify RGL3 interaction partners under different hormone treatments

  • Map domains responsible for specific interactions

  • Determine how interactions change during development and stress responses

• Step 4: Validate key regulatory connections

  • Generate targeted mutations in interaction domains

  • Create higher-order mutants with components of multiple signaling pathways

  • Test predictions using reporter gene assays and phenotypic analyses

By implementing this comprehensive approach, researchers can build a detailed understanding of how RGL3 functions at the intersection of multiple signaling pathways in both plant defense responses and developmental processes.

What technical challenges might researchers encounter when working with RGL3 antibodies and how can these be overcome?

Researchers working with RGL3 antibodies may face several technical challenges that require specific troubleshooting approaches:

Challenge 1: Cross-reactivity with other DELLA proteins

In plant systems, the high sequence similarity among DELLA family members can lead to antibody cross-reactivity. To address this:

• Use genetic controls including single della mutants and higher-order mutants

• Perform peptide competition assays using unique peptide sequences from different DELLA proteins

• Consider developing monoclonal antibodies against highly specific regions of RGL3

• Validate using epitope-tagged versions of RGL3 in della null backgrounds

Challenge 2: Low endogenous expression levels

RGL3 often shows lower baseline expression compared to other DELLA proteins, making detection challenging:

• Implement signal amplification methods such as tyramide signal amplification for immunohistochemistry

• Use enrichment approaches (immunoprecipitation followed by immunoblotting)

• Consider more sensitive detection methods like proximity ligation assay

• Take advantage of hormone treatments (e.g., JA) that upregulate RGL3 expression

Challenge 3: Post-translational modifications affecting epitope recognition

DELLA proteins undergo various post-translational modifications that may affect antibody binding:

• Use multiple antibodies recognizing different epitopes

• Compare detection patterns under conditions that alter post-translational modifications

• Consider phosphatase treatment of samples if phosphorylation might mask epitopes

• Analyze both denaturing and native conditions to account for conformational epitopes

Challenge 4: Optimizing immunohistochemistry protocols

For tissue localization studies, achieving specific signal while minimizing background can be difficult:

• Optimize fixation conditions (duration, fixative composition)

• Test multiple antigen retrieval methods

• Determine optimal antibody concentration through titration experiments (starting with manufacturer recommendations like 1:20-1:50 for HPA043615)

• Include appropriate blocking reagents to minimize non-specific binding

• Use fluorescent secondary antibodies for improved signal-to-noise ratio

By anticipating these challenges and implementing appropriate controls and optimization strategies, researchers can maximize the reliability and specificity of their RGL3 antibody-based experiments.