rpl301 Antibody

Shipped with Ice Packs
In Stock

Description

Antibody Description

  • Target: Ribosomal Protein L30 (RPL30), a 13 kDa protein encoded by the RPL30 gene (NCBI Gene ID: 6156) .

  • Immunogen: Varies by manufacturer:

    • Bio-Rad: Synthetic peptide from the middle region of human RPL30 .

    • Proteintech: Recombinant fusion protein Ag11381 .

    • Sigma-Aldrich: Peptide sequence INSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK .

  • Host/Isotype: Rabbit polyclonal IgG .

Applications and Dilutions

ApplicationDilution RangeSource
Western Blotting (WB)1:500–1:2000
Immunohistochemistry (IHC)1:50–1:500
Immunofluorescence (IF)1:50–1:100
ELISA1:500–1:1000

Key Notes:

  • WB Optimization: Recommended starting dilution for WB is 1/1000 (Bio-Rad) or 1:500–1:1000 (Proteintech) .

  • Cross-Reactivity: Validated for human, mouse, and rat samples, with broader species reactivity noted in .

Reactivity and Cross-Species Validation

SpeciesReactivitySource
HumanPrimary target
MouseConfirmed
RatConfirmed
Monkey/Cow/RabbitLimited data (reported in )

Research Findings

  • Ribosomal Stress Response: RPL30 regulates ribosome assembly and has been implicated in cellular stress responses, including nutrient deprivation .

  • Cancer Research: Used in proteogenomic studies to identify tumor-specific markers, as highlighted in a 2023 publication .

  • Human Protein Atlas: Integrated into the Human Protein Atlas project for comprehensive tissue profiling (Sigma-Aldrich) .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
rpl301 antibody; rpl3a antibody; SPAC17A5.03 antibody; 60S ribosomal protein L3-A antibody
Target Names
rpl301
Uniprot No.

Target Background

Database Links
Protein Families
Universal ribosomal protein uL3 family
Subcellular Location
Cytoplasm.

Q&A

What is rpl301 and why is it important in research?

rpl301 is a gene encoding a ribosomal protein found in Schizosaccharomyces pombe (fission yeast) with the UniProt Number P40372 and Entrez Gene ID 2542265 . This protein constitutes part of the large 60S ribosomal subunit and plays an essential role in protein synthesis. Studying rpl301 provides valuable insights into eukaryotic ribosome structure and function, translation regulation, and cellular stress responses. The protein serves as an important model for understanding ribosomal biology across species, as ribosomal proteins are highly conserved evolutionary markers.

What are the key specifications of commercially available rpl301 antibodies?

Commercial rpl301 antibodies typically present with the following specifications:

SpecificationDetails
Host SpeciesRabbit (most common)
ClonalityPolyclonal
ReactivityPrimarily yeast (S. pombe)
ApplicationsELISA, Western Blot
ImmunogenRecombinant S. pombe rpl301 protein
PurificationAntigen affinity purification
Storage-20°C or -80°C
ComponentsOften includes antigens (positive control) and pre-immune serum (negative control)

These specifications ensure appropriate experimental design and interpretation of results when working with rpl301 in research settings.

How does rpl301 differ from the human RPL30 protein?

While they share functional similarity as ribosomal proteins, rpl301 from S. pombe and human RPL30 have important distinctions:

Human RPL30 is part of the 60S ribosomal subunit with a calculated molecular weight of approximately 13 kDa (115 amino acids) , while the yeast rpl301 functions in a similar capacity but with sequence divergence reflecting evolutionary distance. Human RPL30 antibodies typically show reactivity across multiple mammalian species including human, mouse, and rat , whereas rpl301 antibodies are specifically designed for yeast research applications . Understanding these differences is crucial when designing cross-species studies or interpreting conservation of ribosomal protein function across evolutionary boundaries.

What are the optimal conditions for using rpl301 antibody in Western blot applications?

For optimal Western blot performance with rpl301 antibody:

  • Sample preparation:

    • Use glass bead lysis or enzymatic methods optimized for yeast cells

    • Include protease inhibitor cocktail to prevent degradation

    • Load 15-20 μg total protein per lane

  • Electrophoresis and transfer:

    • Use 12-15% SDS-PAGE gels for optimal resolution

    • Transfer to PVDF membrane at 100V for 1 hour

  • Antibody incubation:

    • Block with 5% non-fat milk in TBST for 1 hour at room temperature

    • Dilute rpl301 antibody 1:500-1:1000 in blocking buffer

    • Incubate overnight at 4°C with gentle agitation

    • Wash 4-5 times with TBST, 5 minutes each

    • Incubate with appropriate HRP-conjugated secondary antibody

  • Detection and controls:

    • Use enhanced chemiluminescence for detection

    • Include provided positive control antigen and pre-immune serum negative control

    • Consider a loading control appropriate for yeast lysates

How can I troubleshoot non-specific binding or weak signals when using rpl301 antibody?

When encountering detection issues with rpl301 antibody:

For weak signals:

  • Increase antibody concentration (1:250 dilution)

  • Extend primary antibody incubation time (overnight at 4°C)

  • Optimize protein extraction buffer to improve antigen availability

  • Increase protein loading (up to 30μg)

  • Employ a more sensitive detection system

For non-specific binding:

  • Increase blocking concentration (5-10% blocking agent)

  • Add 0.1-0.3% Tween-20 to washing buffer

  • Extend washing steps (5-6 washes, 10 minutes each)

  • Pre-adsorb antibody with yeast lysate lacking the target

  • Try alternative blocking agents (casein, fish gelatin)

Systematic optimization can be achieved by testing multiple parameters:

ParameterTest Range
Antibody dilution1:250 - 1:2000
Blocking agentBSA, milk, casein
Blocking time1-3 hours
Wash buffer composition0.05-0.3% Tween-20
Incubation temperature4°C, RT

What modifications are needed for using rpl301 antibody in immunofluorescence microscopy of yeast cells?

For effective immunofluorescence microscopy with rpl301 antibody:

  • Cell fixation and permeabilization:

    • Fix cells with 4% paraformaldehyde for 30 minutes

    • Create spheroplasts using zymolyase treatment (optimize concentration and time)

    • Permeabilize with 0.1% Triton X-100 for 10 minutes

  • Antibody incubation:

    • Block with 3% BSA in PBS for 1 hour

    • Apply primary rpl301 antibody at 1:50-1:100 dilution

    • Incubate overnight at 4°C in humidity chamber

    • Wash extensively with PBS (4-5 times, 5 minutes each)

    • Apply fluorophore-conjugated secondary antibody

  • Imaging considerations:

    • Use appropriate filters based on secondary antibody fluorophore

    • Capture Z-stack images to account for 3D cell structure

    • Include counterstaining for nuclei (DAPI) and cell wall (calcofluor white)

  • Controls:

    • Include secondary-only control to assess background

    • Use pre-immune serum as negative control

    • Consider co-staining with nucleolar markers for colocalization analysis

How can rpl301 antibody be used to study ribosome biogenesis in yeast models?

Studying ribosome biogenesis with rpl301 antibody requires sophisticated experimental approaches:

  • Nuclear-cytoplasmic fractionation:

    • Separate nuclear and cytoplasmic components through differential centrifugation

    • Use Western blotting with rpl301 antibody to track protein localization

    • Compare distribution under normal conditions versus stress or inhibitor treatment

  • Pulse-chase analysis:

    • Label newly synthesized proteins with radioisotopes or click chemistry

    • Immunoprecipitate rpl301-containing complexes at different time points

    • Analyze incorporation kinetics into mature ribosomes

  • Co-immunoprecipitation studies:

    • Use rpl301 antibody to pull down associated factors

    • Analyze interacting proteins by mass spectrometry

    • Compare interactome changes during different biogenesis stages

  • Combined with genetic approaches:

    • Study rpl301 incorporation in strains with mutations in assembly factors

    • Use temperature-sensitive mutants to create synchronized biogenesis defects

    • Compare results with other ribosomal protein antibodies for comprehensive analysis

This multifaceted approach provides insights into the temporal sequence of ribosome assembly and the functional importance of rpl301 in the process.

What considerations are important when using rpl301 antibody for ribosome profiling experiments?

When incorporating rpl301 antibody into ribosome profiling workflows:

  • Pre-profiling validation:

    • Verify ribosome integrity by Western blotting across fractions

    • Ensure antibody specificity in the context of ribosome complexes

    • Optimize immunoprecipitation conditions for intact ribosome recovery

  • Experimental design:

    • Consider selective ribosome profiling by immunoprecipitating rpl301-containing ribosomes

    • Compare total ribosome profiling with rpl301-specific profiles

    • Include appropriate controls (input RNA, non-specific antibody pull-down)

  • Technical considerations:

    • Buffer optimization to maintain ribosome integrity during immunoprecipitation

    • RNase treatment calibration for optimal footprint generation

    • RNA recovery methods compatible with immunoprecipitation protocols

  • Data analysis:

    • Normalize for potential biases introduced by immunoprecipitation

    • Compare ribosome occupancy patterns between total and rpl301-enriched samples

    • Apply appropriate statistical methods for differential translation analysis

This approach can reveal specific populations of ribosomes and their association with distinct mRNA subsets.

How can rpl301 antibody be utilized for studying ribosomal protein post-translational modifications?

Investigating post-translational modifications (PTMs) of rpl301 requires specialized approaches:

  • PTM detection strategies:

    • Immunoprecipitate with rpl301 antibody and probe with modification-specific antibodies

    • Use 2D gel electrophoresis to separate modified forms before Western blotting

    • Perform phosphatase or deubiquitinase treatments to confirm modification types

  • Mass spectrometry workflow:

    • Immunoprecipitate rpl301 using the specific antibody

    • Perform on-bead or in-solution digestion with appropriate proteases

    • Use enrichment strategies for specific modifications (e.g., TiO₂ for phosphopeptides)

    • Analyze with high-resolution MS and appropriate fragmentation methods

  • Comparative analysis:

    • Study modification changes across growth conditions and stress responses

    • Compare modifications between wild-type and mutant strains

    • Analyze temporal dynamics following environmental perturbations

  • Functional correlation:

    • Correlate modification patterns with ribosome activity

    • Assess impact on protein-protein interactions

    • Determine effects on translation efficiency or selectivity

This comprehensive approach provides insight into how PTMs regulate ribosomal function through rpl301 modifications.

How can rpl301 antibody be used in comparative studies across different yeast species?

Using rpl301 antibody for cross-species studies requires careful consideration:

  • Sequence homology assessment:

    • Perform alignment of rpl301 sequences across target yeast species

    • Identify regions of conservation that may contain the epitope

    • Predict potential cross-reactivity based on sequence similarity

  • Cross-reactivity validation:

    • Test antibody against lysates from multiple yeast species (S. cerevisiae, C. albicans, etc.)

    • Perform titration experiments to determine relative affinity

    • Consider Western blotting with decreasing protein amounts to assess sensitivity limits

  • Optimization strategies:

    • Adjust antibody concentrations based on species-specific affinity

    • Modify incubation conditions for optimal detection across species

    • Consider using multiple antibodies targeting different epitopes for confirmation

  • Data interpretation:

    • Account for evolutionary relationships when interpreting results

    • Consider functional conservation despite sequence divergence

    • Use bioinformatic tools to correlate antibody reactivity with sequence conservation

This approach enables evolutionary studies of ribosomal biology across the fungal kingdom.

What are the considerations when comparing data between rpl301 (yeast) and human RPL30 studies?

When comparing studies using yeast rpl301 antibody and human RPL30 antibody:

  • Evolutionary context:

    • Recognize that while functionally similar, these proteins have diverged significantly

    • Consider that human RPL30 and yeast rpl301 may have evolved specialized functions

    • Understand that extrapolation between systems requires validation

  • Technical considerations:

    • Different antibodies have unique specificity and sensitivity profiles

    • Experimental conditions optimized for one system may not transfer directly

    • Standard protocols may require significant modification between systems

  • Methodological approach:

    • Use purified recombinant proteins from both species as controls

    • Perform parallel experiments with both antibodies when possible

    • Consider complementary methods (mass spectrometry, genetic approaches)

  • Data interpretation framework:

    • Focus on conserved functions rather than species-specific details

    • Validate key findings across both systems when making translational claims

    • Use bioinformatic approaches to identify truly conserved aspects

Understanding these considerations enables proper interpretation of comparative ribosome biology across evolutionary distances.

How can I quantitatively assess rpl301 antibody specificity and sensitivity?

For rigorous quantitative assessment of rpl301 antibody performance:

  • Titration analysis:

    • Perform serial dilutions of yeast lysate (2-fold dilutions)

    • Plot signal intensity versus protein amount to determine linear range

    • Calculate limit of detection (LOD) and limit of quantification (LOQ)

  • Specificity assessment:

    • Conduct peptide competition assays with immunizing antigen

    • Test against lysates from rpl301 deletion or depletion strains if available

    • Assess cross-reactivity with closely related ribosomal proteins

  • Quantitative metrics:

    • Signal-to-noise ratio across different sample types

    • Coefficient of variation in replicate experiments

    • Recovery efficiency in immunoprecipitation experiments

  • Validation with orthogonal methods:

    • Compare antibody-based quantification with mass spectrometry

    • Correlate with RNA expression data when appropriate

    • Verify with genetically tagged versions of the protein

This thorough characterization ensures reliable interpretation of experimental results and appropriate method selection.

What controls are essential when using rpl301 antibody in different experimental applications?

Essential controls for experimental rigor when using rpl301 antibody include:

ApplicationPositive ControlsNegative ControlsTechnical Controls
Western BlotProvided antigen , Recombinant rpl301Pre-immune serum , Non-expressing sampleLoading control, MW marker
ImmunoprecipitationInput sample, Known interactorPre-immune serum IP , IgG-only beadsIsotype control antibody
ImmunofluorescenceKnown localization patternSecondary antibody only, Pre-immune serum Counterstains for cellular landmarks
ELISAStandard curve with antigenBlocking buffer onlyInter-assay calibrator
ChIPKnown binding regionNon-target region, IgG ChIPInput normalization

Implementing these controls ensures experimental validity and facilitates troubleshooting when unexpected results occur.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.