MRPL17 Antibody

Shipped with Ice Packs
In Stock

Description

Overview of MRPL17 Antibody

MRPL17 antibodies are immunoreagents designed to detect the MRPL17 protein, which is encoded by the MRPL17 gene (Entrez Gene ID: 63875 in humans). These antibodies are predominantly rabbit-derived polyclonals validated for techniques such as ELISA, immunohistochemistry (IHC), and immunofluorescence (IF). Key characteristics include:

PropertyDetails
Host SpeciesRabbit
ReactivityHuman, Mouse, Rat
ApplicationsELISA, IHC, IF, Western Blot (WB)
ImmunogenRecombinant MRPL17 fusion protein or specific peptide sequences
Molecular Weight~20 kDa (predicted)
UniProt IDsQ9NRX2 (Human), Q9D8P4 (Mouse)
Commercial SuppliersProteintech, Thermo Fisher Scientific, Sigma-Aldrich, Atlas Antibodies

Sources:

Proteintech MRPL17 Antibody (17214-1-AP)

  • Applications: ELISA

  • Conjugate: Unconjugated

  • Immunogen: MRPL17 fusion protein expressed in E. coli

  • Storage: -20°C in PBS with 0.02% sodium azide and 50% glycerol .

Thermo Fisher PA5-75713

  • Applications: WB, IHC

  • Specificity: Detects endogenous MRPL17 across human, mouse, and rat samples.

  • Purity: >95% via SDS-PAGE .

Sigma-Aldrich HPA043666

  • Applications: IHC (1:500–1:1000 dilution)

  • Immunogen Sequence: PKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDSHLTLLNQLLQGLRQDLRQSQEASNHSSHT .

Role in Cancer Prognosis

MRPL17 is overexpressed in liver hepatocellular carcinoma (LIHC) and correlates with poor patient outcomes. Key findings include:

Mechanistic Insights

  • Immune Infiltration: MRPL17 expression influences immune cell populations, including dendritic cells, macrophages, and regulatory T cells, within the tumor microenvironment .

  • Proliferation Marker: Positive correlation with KI67 (a proliferation marker) in LIHC tissues (r = 0.62, p < 0.001) .

Validation and Quality Control

Leading antibodies undergo rigorous validation:

  • Proteintech: Verified via ELISA using recombinant protein .

  • Thermo Fisher: Validated in WB and IHC using siRNA knockdown controls .

  • Atlas Antibodies: Enhanced validation through protein array testing (364 human proteins) and IHC across 44 normal and 20 cancer tissues .

Future Directions

MRPL17 antibodies are pivotal for advancing studies on mitochondrial dysfunction in cancer and metabolic diseases. Ongoing research aims to:

  • Elucidate MRPL17's role in mitochondrial translation fidelity.

  • Develop MRPL17-targeted therapies for LIHC and other malignancies .

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
MRPL17 antibody; MRPL30 antibody; YNL252C antibody; N0864 antibody; 54S ribosomal protein L17 antibody; mitochondrial antibody; Mitochondrial large ribosomal subunit protein mL46 antibody; YmL17/YmL30 antibody
Target Names
MRPL17
Uniprot No.

Target Background

Function
MRPL17 is a component of the mitochondrial ribosome (mitoribosome), a specialized translational machinery responsible for synthesizing proteins encoded by the mitochondrial genome. These proteins include essential transmembrane subunits of the mitochondrial respiratory chain. Mitoribosomes are attached to the mitochondrial inner membrane, and their translation products are cotranslationally integrated into the membrane.
Database Links

KEGG: sce:YNL252C

STRING: 4932.YNL252C

Protein Families
Mitochondrion-specific ribosomal protein mL46 family
Subcellular Location
Mitochondrion.

Q&A

What is MRPL17 and what is its biological significance in research?

MRPL17 (also known as MRP-L26 or RPML26) is a component of the large 39S subunit of the mitochondrial ribosome. It plays a crucial role in mitochondrial protein synthesis, which is essential for oxidative phosphorylation and cellular energy production. In recent research, MRPL17 has emerged as a significant biomarker in cancer biology, particularly in liver cancer, where it has been identified as one of 14 essential stem cell-related genes . Through single-cell RNA sequencing and machine learning analyses, MRPL17 has been linked to cancer progression, stemness, and patient prognosis . Its expression correlates with poor outcomes in liver hepatocellular carcinoma (LIHC) patients and shows positive association with proliferation markers like KI67 .

To investigate MRPL17's biological functions, researchers typically employ loss-of-function studies using RNA interference (siRNA or shRNA) followed by assessments of mitochondrial translation efficiency, oxygen consumption, and ATP production. Gain-of-function studies using overexpression vectors can complement these approaches to provide comprehensive insights into MRPL17's cellular roles.

What are the optimal conditions for Western blotting with MRPL17 antibodies?

For successful Western blot detection of MRPL17, researchers should consider these methodological guidelines:

Sample Preparation:

  • Extract proteins using RIPA buffer supplemented with protease inhibitors

  • For mitochondrial enrichment, consider mitochondrial isolation before protein extraction

  • Load 20-40 μg of total protein per lane

Gel and Transfer Parameters:

  • Use 12-15% SDS-PAGE gels (MRPL17 has a molecular weight of approximately 20 kDa)

  • Transfer to 0.2 μm PVDF membrane (recommended for small proteins)

  • Use semi-dry transfer (15V, 30 minutes) or wet transfer (100V, 1 hour)

Antibody Incubation:

  • Block with 5% non-fat milk in TBST for 1 hour at room temperature

  • Incubate with primary MRPL17 antibody at 1:500-1:1000 dilution in 5% BSA overnight at 4°C

  • Wash 3-4 times with TBST, 5-10 minutes each

  • Incubate with appropriate HRP-conjugated secondary antibody (anti-rabbit for polyclonal antibodies) at 1:5000 dilution for 1 hour

Troubleshooting Tips:

  • If signal is weak, increase antibody concentration or extend incubation time

  • If background is high, increase blocking time or reduce antibody concentration

  • Verify antibody specificity using positive controls and MRPL17 knockdown samples

What are appropriate positive controls for MRPL17 antibody validation?

Based on available research data, the following samples serve as reliable positive controls:

Cell Lines:

  • HepG2 (human liver cancer cell line)

  • HeLa (human cervical cancer cell line)

  • HEK293 (human embryonic kidney cells)

Tissue Samples:

  • Liver hepatocellular carcinoma tissues (show significantly elevated MRPL17 expression)

  • Normal liver tissue (as a comparative control)

  • Tissues with high mitochondrial content (kidney, heart, brain)

For comprehensive validation, researchers should:

  • Include both positive controls and negative controls (MRPL17 knockdown cells)

  • Verify the detection of a band at approximately 20 kDa in Western blotting

  • For immunohistochemistry validation, use liver cancer tissue sections which exhibit significantly increased MRPL17 expression compared to normal liver tissue

How can researchers assess the specificity of MRPL17 antibodies?

Ensuring antibody specificity is critical for generating reliable experimental results. Multiple complementary approaches include:

RNA Interference Validation:

  • Transfect cells with siRNA or shRNA targeting MRPL17

  • Compare antibody staining between knockdown and control samples

  • A specific antibody will show significantly reduced signal in knockdown samples

Overexpression System Validation:

  • Transfect cells with an expression vector containing MRPL17 with an epitope tag

  • Perform Western blotting with both MRPL17 antibody and tag-specific antibody

  • Colocalization of signals confirms specificity

Peptide Competition Assay:

  • Pre-incubate the MRPL17 antibody with excess immunizing peptide

  • Apply to Western blots or immunostaining

  • Signal abolishment indicates epitope specificity

Multiple Antibody Comparison:

  • Use antibodies targeting different MRPL17 epitopes

  • Consistent results across different antibodies support specificity

  • For commercially available antibodies, assess immunogen information (e.g., "amino acids 86-175 of human MRPL17" for CAB15603)

Mass Spectrometry Validation:

  • Perform immunoprecipitation with the MRPL17 antibody

  • Analyze precipitated proteins by mass spectrometry

  • Confirmation of MRPL17 presence validates antibody specificity

What are the recommended immunohistochemistry protocols for MRPL17 detection?

For optimal immunohistochemical detection of MRPL17 in tissue samples:

Fixation and Processing:

  • FFPE tissues: Fix in 10% neutral buffered formalin for 24 hours

  • Frozen sections: Snap-freeze in OCT compound, cut 5-7 μm sections, fix in cold acetone

Immunohistochemistry Protocol:

  • Deparaffinize and rehydrate FFPE sections

  • Perform heat-induced epitope retrieval in citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) for 15-20 minutes

  • Block endogenous peroxidase with 3% hydrogen peroxide (10 minutes)

  • Block with 5% normal serum (1 hour at room temperature)

  • Incubate with primary MRPL17 antibody at 1:500-1:1000 dilution overnight at 4°C

  • Apply appropriate secondary antibody and develop with DAB substrate

  • Counterstain with hematoxylin

For Immunofluorescence:

  • Follow steps 1-5 as above

  • Apply fluorophore-conjugated secondary antibody (1:200-1:500)

  • Counterstain nuclei with DAPI

  • Mount with anti-fade medium

For colocalization studies, consider co-staining with mitochondrial markers such as TOMM20 or MitoTracker dyes to confirm mitochondrial localization.

How can MRPL17 antibodies be used to study cancer stem cell properties?

Recent research has identified MRPL17 as one of 14 essential stem cell-related genes in liver cancer . Researchers can investigate this association through several approaches:

Multiplex Immunofluorescence Analysis:

  • Co-stain tissue sections for MRPL17 and established cancer stem cell markers (CD133, CD44, EpCAM)

  • Use multispectral imaging systems for accurate signal separation

  • Quantify colocalization using Pearson's or Mander's correlation coefficients

  • Analyze spatial relationships between MRPL17-positive cells and stem cell populations

Flow Cytometry and Cell Sorting:

  • Dissociate tumor tissues into single-cell suspensions

  • Stain for cell surface stem cell markers and permeabilize for MRPL17 staining

  • Sort cell populations based on stem cell marker expression

  • Analyze MRPL17 levels in stem and non-stem populations

Functional Validation Studies:

  • Generate MRPL17 knockdown and overexpression models

  • Assess impact on:

    • Sphere formation capacity (tumorsphere assays)

    • Expression of stem cell transcription factors (SOX2, OCT4, NANOG)

    • ALDH activity using ALDEFLUOR assay

    • In vivo tumor initiation capacity with limiting dilution assays

Single-cell Analysis:

  • Perform single-cell RNA sequencing on tumor samples

  • Identify cell clusters using non-negative matrix factorization

  • Analyze MRPL17 expression across different clusters, particularly focusing on stem cell populations

  • Validate findings at protein level using methods described above

Research has demonstrated that MRPL17 expression correlates with stemness scores in liver cancer, and machine learning algorithms have identified it as a critical gene for LIHC prognosis . This provides a strong foundation for investigating its role in cancer stem cell biology.

What techniques can be used to study MRPL17's relationship with immune cell infiltration?

Published research indicates that MRPL17 expression levels in LIHC correlate with immune cell infiltration patterns . To investigate this relationship:

Multiplex Immunohistochemistry/Immunofluorescence:

  • Design panels including MRPL17 and immune cell markers:

    • T cells (CD3, CD4, CD8, FOXP3)

    • Macrophages (CD68, CD163, iNOS)

    • Dendritic cells (CD11c)

    • B cells (CD20)

    • NK cells (CD56)

  • Perform spatial analysis:

    • Quantify immune cell densities in MRPL17-high versus MRPL17-low regions

    • Measure distances between MRPL17-positive cells and immune cells

    • Identify clustering patterns using nearest neighbor analysis

Computational Immune Cell Quantification:

  • Analyze gene expression data to correlate MRPL17 levels with immune signatures

  • Apply computational methods such as:

    • XCELL algorithm for cell type enrichment analysis

    • TIP algorithm for immune cell infiltration assessment

    • CIBERSORT for estimating immune cell fractions

Table 1: Differential Immune Cell Infiltration in MRPL17-High vs. MRPL17-Low LIHC

Immune Cell TypeAssociation with High MRPL17Statistical Significance
Activated myeloid dendritic cellsAlteredSignificant
M1 macrophagesAlteredSignificant
M2 macrophagesAlteredSignificant
Granulocyte-monocyte progenitorsAlteredSignificant
Regulatory T cells (Tregs)AlteredSignificant
CD4+ Th2 T cellsAlteredSignificant
B cellsAlteredSignificant

Research has shown that patients with high MRPL17 expression exhibited elevated TIDE scores, suggesting less effective responses to immunotherapy . This indicates MRPL17 may serve as a potential predictive marker for immunotherapy response.

How should researchers design experiments to validate MRPL17 as a prognostic biomarker?

Based on published findings demonstrating MRPL17's correlation with poor prognosis in liver cancer , researchers can validate its prognostic value through:

Cohort Design and Sample Collection:

MRPL17 Expression Analysis:

  • Construct tissue microarrays with multiple cores per case

  • Implement standardized immunohistochemistry protocols with validated MRPL17 antibodies

  • Use digital image analysis for objective quantification

  • Have multiple pathologists score samples independently while blinded to clinical data

Statistical Analysis:

  • Determine optimal cut-off values using:

    • ROC curve analysis

    • Minimum p-value approach

  • Perform survival analysis:

    • Kaplan-Meier curves with log-rank tests

    • Cox proportional hazards regression

  • Conduct multivariate analysis including established prognostic factors

Predictive Value Assessment:

  • Stratify patients by treatment received

  • Analyze interaction between MRPL17 expression and treatment benefit

  • Evaluate MRPL17 as a potential biomarker for treatment selection

Research has demonstrated that high MRPL17 expression correlates with poor prognosis in LIHC patients . Additionally, MRPL17 expression has been linked with tumor proliferation and epithelial-mesenchymal transition pathways , which are known drivers of cancer progression and metastasis.

What methodologies should be used to investigate MRPL17's role in mitochondrial dysfunction in cancer?

To examine MRPL17's impact on mitochondrial function in cancer:

Functional Mitochondrial Assays:

  • Compare cancer cells with different MRPL17 expression levels:

    • Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using Seahorse XF Analyzer

    • Mitochondrial membrane potential using JC-1 or TMRM dyes

    • ATP production using luminescence-based assays

    • ROS levels using DCFDA or MitoSOX Red

    • Mitochondrial morphology using confocal microscopy

Gene Expression Analysis:

  • Evaluate MRPL17 knockdown effects on:

    • Mitochondrial translation efficiency

    • Expression of nuclear-encoded mitochondrial genes

    • Mitochondrial DNA copy number

    • Expression of other mitochondrial ribosomal proteins

Multi-omics Integration:

  • Combine MRPL17 protein expression data with transcriptomic and metabolomic datasets

  • Identify metabolic pathways altered in samples with high versus low MRPL17 expression

  • Analyze correlation between MRPL17 and oxidative phosphorylation pathway components

Research has shown that MRPL17 expression is associated with cellular proliferation , which is often linked to metabolic reprogramming in cancer cells. The positive correlation between MRPL17 and KI67 expression further suggests its involvement in regulating cancer cell proliferation, potentially through modulating mitochondrial function.

How can researchers effectively use RNA interference to study MRPL17 function?

For robust RNA interference experiments targeting MRPL17:

siRNA Design and Selection:

  • Design 3-4 independent siRNAs targeting different regions of MRPL17 mRNA

  • Target conserved exons present in all transcript variants

  • Avoid regions with SNPs or mutations

  • Select sequences with 30-50% GC content

  • Check for off-target effects using BLAST

Experimental Design:

  • Cell line selection:

    • Use cancer cell lines with detectable baseline MRPL17 expression

    • For liver cancer studies: HepG2, Hep3B, Huh7

  • Include appropriate controls:

    • Non-targeting siRNA control

    • Mock transfection control

    • Untreated control

Knockdown Validation:

  • Confirm at mRNA level using qRT-PCR (24-48 hours post-transfection)

  • Verify at protein level using Western blotting with MRPL17 antibody (48-72 hours post-transfection)

  • Quantify knockdown efficiency by densitometry

Functional Analysis:

  • Mitochondrial function assessment:

    • Oxygen consumption rate

    • Mitochondrial membrane potential

    • ATP production

  • Cancer-related phenotypes:

    • Proliferation assays

    • Cell cycle analysis

    • Migration and invasion assays

    • Sphere formation assay (for cancer stem cell properties)

Rescue Experiments:

  • Generate an siRNA-resistant MRPL17 expression construct

  • Co-transfect with siRNA to demonstrate specificity of observed effects

Based on published research, MRPL17 knockdown would be expected to reduce cell proliferation and stem cell characteristics in liver cancer cells , potentially affecting pathways related to epithelial-mesenchymal transition as indicated by pathway enrichment analyses.

What are the best approaches for multiplexed immunofluorescence including MRPL17?

For effective multiplexed immunofluorescence incorporating MRPL17:

Panel Design:

  • Antibody selection:

    • Use primary antibodies from different host species when possible

    • Ensure antibodies are validated for immunofluorescence

  • Example MRPL17-focused panels:

    • Mitochondrial panel: MRPL17 + TOMM20 + COX IV

    • Cancer stem cell panel: MRPL17 + CD133 + CD44 + EpCAM

    • Proliferation panel: MRPL17 + Ki67

Sequential Staining Protocol:

  • Perform heat-induced epitope retrieval

  • Block with appropriate serum

  • Apply primary MRPL17 antibody (1:100-1:500)

  • Detect with fluorophore-conjugated secondary antibody or tyramide signal amplification

  • If using tyramide amplification, perform antibody stripping while preserving fluorophore signal

  • Repeat cycles for additional targets

  • Counterstain with DAPI and mount with anti-fade medium

Imaging and Analysis:

  • Use multispectral imaging systems for accurate signal separation

  • Perform cell-by-cell quantification of marker expression

  • Analyze colocalization using appropriate statistical methods

  • Examine spatial relationships between differently labeled cells

Published research has successfully used multiplexed immunofluorescence to demonstrate elevated MRPL17 expression in liver hepatocellular carcinoma compared to normal liver tissue, as well as its correlation with Ki67 expression . This approach provides valuable spatial context for understanding MRPL17's relationships with other proteins in the tumor microenvironment.

How can researchers integrate MRPL17 data into multi-omics cancer studies?

For comprehensive multi-omics integration of MRPL17 data:

Data Collection Across Platforms:

  • Protein expression: Immunohistochemistry, Western blotting, proteomics

  • mRNA expression: qRT-PCR, RNA-seq, microarray

  • Epigenetic regulation: DNA methylation, chromatin accessibility

  • Functional readouts: Metabolomics, mitochondrial function assays

Integration Methods:

  • Correlation analyses between MRPL17 expression and:

    • Gene expression signatures (stemness, proliferation)

    • Metabolic pathway activities

    • Immune infiltration patterns

  • Machine learning approaches:

    • Use algorithms like XGBoost to identify relationships between MRPL17 and patient outcomes

    • Perform similarity network fusion to integrate multi-omics data

    • Apply MOFA (Multi-Omics Factor Analysis) to identify joint factors

Visualization Techniques:

  • Create multi-omics heatmaps with samples clustered by MRPL17 expression

  • Generate network diagrams showing relationships between MRPL17 and other molecular features

  • Develop interactive dashboards for data exploration

Validation Approaches:

  • Test hypotheses generated from computational analyses in experimental models

  • Confirm findings across independent datasets

  • Validate clinically relevant associations in prospective studies

Research has demonstrated that integrative analyses incorporating MRPL17 can yield important insights into cancer biology. For example, computational analyses identified MRPL17 as the most critical gene for LIHC prognosis among 14 stem cell-related genes . Additionally, pathway analyses revealed associations between MRPL17 expression and tumor proliferation as well as epithelial-mesenchymal transition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.