MRPL17 antibodies are immunoreagents designed to detect the MRPL17 protein, which is encoded by the MRPL17 gene (Entrez Gene ID: 63875 in humans). These antibodies are predominantly rabbit-derived polyclonals validated for techniques such as ELISA, immunohistochemistry (IHC), and immunofluorescence (IF). Key characteristics include:
| Property | Details |
|---|---|
| Host Species | Rabbit |
| Reactivity | Human, Mouse, Rat |
| Applications | ELISA, IHC, IF, Western Blot (WB) |
| Immunogen | Recombinant MRPL17 fusion protein or specific peptide sequences |
| Molecular Weight | ~20 kDa (predicted) |
| UniProt IDs | Q9NRX2 (Human), Q9D8P4 (Mouse) |
| Commercial Suppliers | Proteintech, Thermo Fisher Scientific, Sigma-Aldrich, Atlas Antibodies |
Applications: ELISA
Conjugate: Unconjugated
Immunogen: MRPL17 fusion protein expressed in E. coli
Storage: -20°C in PBS with 0.02% sodium azide and 50% glycerol .
Applications: WB, IHC
Specificity: Detects endogenous MRPL17 across human, mouse, and rat samples.
Applications: IHC (1:500–1:1000 dilution)
Immunogen Sequence: PKLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEYKGNCLPPLPLPRRDSHLTLLNQLLQGLRQDLRQSQEASNHSSHT .
MRPL17 is overexpressed in liver hepatocellular carcinoma (LIHC) and correlates with poor patient outcomes. Key findings include:
Immune Infiltration: MRPL17 expression influences immune cell populations, including dendritic cells, macrophages, and regulatory T cells, within the tumor microenvironment .
Proliferation Marker: Positive correlation with KI67 (a proliferation marker) in LIHC tissues (r = 0.62, p < 0.001) .
Leading antibodies undergo rigorous validation:
Thermo Fisher: Validated in WB and IHC using siRNA knockdown controls .
Atlas Antibodies: Enhanced validation through protein array testing (364 human proteins) and IHC across 44 normal and 20 cancer tissues .
MRPL17 antibodies are pivotal for advancing studies on mitochondrial dysfunction in cancer and metabolic diseases. Ongoing research aims to:
KEGG: sce:YNL252C
STRING: 4932.YNL252C
MRPL17 (also known as MRP-L26 or RPML26) is a component of the large 39S subunit of the mitochondrial ribosome. It plays a crucial role in mitochondrial protein synthesis, which is essential for oxidative phosphorylation and cellular energy production. In recent research, MRPL17 has emerged as a significant biomarker in cancer biology, particularly in liver cancer, where it has been identified as one of 14 essential stem cell-related genes . Through single-cell RNA sequencing and machine learning analyses, MRPL17 has been linked to cancer progression, stemness, and patient prognosis . Its expression correlates with poor outcomes in liver hepatocellular carcinoma (LIHC) patients and shows positive association with proliferation markers like KI67 .
To investigate MRPL17's biological functions, researchers typically employ loss-of-function studies using RNA interference (siRNA or shRNA) followed by assessments of mitochondrial translation efficiency, oxygen consumption, and ATP production. Gain-of-function studies using overexpression vectors can complement these approaches to provide comprehensive insights into MRPL17's cellular roles.
For successful Western blot detection of MRPL17, researchers should consider these methodological guidelines:
Sample Preparation:
Extract proteins using RIPA buffer supplemented with protease inhibitors
For mitochondrial enrichment, consider mitochondrial isolation before protein extraction
Load 20-40 μg of total protein per lane
Gel and Transfer Parameters:
Use 12-15% SDS-PAGE gels (MRPL17 has a molecular weight of approximately 20 kDa)
Transfer to 0.2 μm PVDF membrane (recommended for small proteins)
Use semi-dry transfer (15V, 30 minutes) or wet transfer (100V, 1 hour)
Antibody Incubation:
Block with 5% non-fat milk in TBST for 1 hour at room temperature
Incubate with primary MRPL17 antibody at 1:500-1:1000 dilution in 5% BSA overnight at 4°C
Wash 3-4 times with TBST, 5-10 minutes each
Incubate with appropriate HRP-conjugated secondary antibody (anti-rabbit for polyclonal antibodies) at 1:5000 dilution for 1 hour
Troubleshooting Tips:
If signal is weak, increase antibody concentration or extend incubation time
If background is high, increase blocking time or reduce antibody concentration
Verify antibody specificity using positive controls and MRPL17 knockdown samples
Based on available research data, the following samples serve as reliable positive controls:
Cell Lines:
HepG2 (human liver cancer cell line)
HeLa (human cervical cancer cell line)
HEK293 (human embryonic kidney cells)
Tissue Samples:
Liver hepatocellular carcinoma tissues (show significantly elevated MRPL17 expression)
Normal liver tissue (as a comparative control)
Tissues with high mitochondrial content (kidney, heart, brain)
For comprehensive validation, researchers should:
Include both positive controls and negative controls (MRPL17 knockdown cells)
Verify the detection of a band at approximately 20 kDa in Western blotting
For immunohistochemistry validation, use liver cancer tissue sections which exhibit significantly increased MRPL17 expression compared to normal liver tissue
Ensuring antibody specificity is critical for generating reliable experimental results. Multiple complementary approaches include:
RNA Interference Validation:
Transfect cells with siRNA or shRNA targeting MRPL17
Compare antibody staining between knockdown and control samples
A specific antibody will show significantly reduced signal in knockdown samples
Overexpression System Validation:
Transfect cells with an expression vector containing MRPL17 with an epitope tag
Perform Western blotting with both MRPL17 antibody and tag-specific antibody
Colocalization of signals confirms specificity
Peptide Competition Assay:
Pre-incubate the MRPL17 antibody with excess immunizing peptide
Apply to Western blots or immunostaining
Signal abolishment indicates epitope specificity
Multiple Antibody Comparison:
Use antibodies targeting different MRPL17 epitopes
Consistent results across different antibodies support specificity
For commercially available antibodies, assess immunogen information (e.g., "amino acids 86-175 of human MRPL17" for CAB15603)
Mass Spectrometry Validation:
Perform immunoprecipitation with the MRPL17 antibody
Analyze precipitated proteins by mass spectrometry
Confirmation of MRPL17 presence validates antibody specificity
For optimal immunohistochemical detection of MRPL17 in tissue samples:
Fixation and Processing:
FFPE tissues: Fix in 10% neutral buffered formalin for 24 hours
Frozen sections: Snap-freeze in OCT compound, cut 5-7 μm sections, fix in cold acetone
Immunohistochemistry Protocol:
Deparaffinize and rehydrate FFPE sections
Perform heat-induced epitope retrieval in citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) for 15-20 minutes
Block endogenous peroxidase with 3% hydrogen peroxide (10 minutes)
Block with 5% normal serum (1 hour at room temperature)
Incubate with primary MRPL17 antibody at 1:500-1:1000 dilution overnight at 4°C
Apply appropriate secondary antibody and develop with DAB substrate
Counterstain with hematoxylin
For Immunofluorescence:
Follow steps 1-5 as above
Apply fluorophore-conjugated secondary antibody (1:200-1:500)
Counterstain nuclei with DAPI
Mount with anti-fade medium
For colocalization studies, consider co-staining with mitochondrial markers such as TOMM20 or MitoTracker dyes to confirm mitochondrial localization.
Recent research has identified MRPL17 as one of 14 essential stem cell-related genes in liver cancer . Researchers can investigate this association through several approaches:
Multiplex Immunofluorescence Analysis:
Co-stain tissue sections for MRPL17 and established cancer stem cell markers (CD133, CD44, EpCAM)
Use multispectral imaging systems for accurate signal separation
Quantify colocalization using Pearson's or Mander's correlation coefficients
Analyze spatial relationships between MRPL17-positive cells and stem cell populations
Flow Cytometry and Cell Sorting:
Dissociate tumor tissues into single-cell suspensions
Stain for cell surface stem cell markers and permeabilize for MRPL17 staining
Sort cell populations based on stem cell marker expression
Analyze MRPL17 levels in stem and non-stem populations
Functional Validation Studies:
Generate MRPL17 knockdown and overexpression models
Assess impact on:
Sphere formation capacity (tumorsphere assays)
Expression of stem cell transcription factors (SOX2, OCT4, NANOG)
ALDH activity using ALDEFLUOR assay
In vivo tumor initiation capacity with limiting dilution assays
Single-cell Analysis:
Perform single-cell RNA sequencing on tumor samples
Identify cell clusters using non-negative matrix factorization
Analyze MRPL17 expression across different clusters, particularly focusing on stem cell populations
Validate findings at protein level using methods described above
Research has demonstrated that MRPL17 expression correlates with stemness scores in liver cancer, and machine learning algorithms have identified it as a critical gene for LIHC prognosis . This provides a strong foundation for investigating its role in cancer stem cell biology.
Published research indicates that MRPL17 expression levels in LIHC correlate with immune cell infiltration patterns . To investigate this relationship:
Multiplex Immunohistochemistry/Immunofluorescence:
Design panels including MRPL17 and immune cell markers:
T cells (CD3, CD4, CD8, FOXP3)
Macrophages (CD68, CD163, iNOS)
Dendritic cells (CD11c)
B cells (CD20)
NK cells (CD56)
Perform spatial analysis:
Quantify immune cell densities in MRPL17-high versus MRPL17-low regions
Measure distances between MRPL17-positive cells and immune cells
Identify clustering patterns using nearest neighbor analysis
Computational Immune Cell Quantification:
Analyze gene expression data to correlate MRPL17 levels with immune signatures
Apply computational methods such as:
| Immune Cell Type | Association with High MRPL17 | Statistical Significance |
|---|---|---|
| Activated myeloid dendritic cells | Altered | Significant |
| M1 macrophages | Altered | Significant |
| M2 macrophages | Altered | Significant |
| Granulocyte-monocyte progenitors | Altered | Significant |
| Regulatory T cells (Tregs) | Altered | Significant |
| CD4+ Th2 T cells | Altered | Significant |
| B cells | Altered | Significant |
Research has shown that patients with high MRPL17 expression exhibited elevated TIDE scores, suggesting less effective responses to immunotherapy . This indicates MRPL17 may serve as a potential predictive marker for immunotherapy response.
Based on published findings demonstrating MRPL17's correlation with poor prognosis in liver cancer , researchers can validate its prognostic value through:
Cohort Design and Sample Collection:
MRPL17 Expression Analysis:
Construct tissue microarrays with multiple cores per case
Implement standardized immunohistochemistry protocols with validated MRPL17 antibodies
Use digital image analysis for objective quantification
Have multiple pathologists score samples independently while blinded to clinical data
Statistical Analysis:
Determine optimal cut-off values using:
ROC curve analysis
Minimum p-value approach
Perform survival analysis:
Kaplan-Meier curves with log-rank tests
Cox proportional hazards regression
Conduct multivariate analysis including established prognostic factors
Predictive Value Assessment:
Stratify patients by treatment received
Analyze interaction between MRPL17 expression and treatment benefit
Evaluate MRPL17 as a potential biomarker for treatment selection
Research has demonstrated that high MRPL17 expression correlates with poor prognosis in LIHC patients . Additionally, MRPL17 expression has been linked with tumor proliferation and epithelial-mesenchymal transition pathways , which are known drivers of cancer progression and metastasis.
To examine MRPL17's impact on mitochondrial function in cancer:
Functional Mitochondrial Assays:
Compare cancer cells with different MRPL17 expression levels:
Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using Seahorse XF Analyzer
Mitochondrial membrane potential using JC-1 or TMRM dyes
ATP production using luminescence-based assays
ROS levels using DCFDA or MitoSOX Red
Mitochondrial morphology using confocal microscopy
Gene Expression Analysis:
Evaluate MRPL17 knockdown effects on:
Mitochondrial translation efficiency
Expression of nuclear-encoded mitochondrial genes
Mitochondrial DNA copy number
Expression of other mitochondrial ribosomal proteins
Multi-omics Integration:
Combine MRPL17 protein expression data with transcriptomic and metabolomic datasets
Identify metabolic pathways altered in samples with high versus low MRPL17 expression
Analyze correlation between MRPL17 and oxidative phosphorylation pathway components
Research has shown that MRPL17 expression is associated with cellular proliferation , which is often linked to metabolic reprogramming in cancer cells. The positive correlation between MRPL17 and KI67 expression further suggests its involvement in regulating cancer cell proliferation, potentially through modulating mitochondrial function.
For robust RNA interference experiments targeting MRPL17:
siRNA Design and Selection:
Design 3-4 independent siRNAs targeting different regions of MRPL17 mRNA
Target conserved exons present in all transcript variants
Avoid regions with SNPs or mutations
Select sequences with 30-50% GC content
Check for off-target effects using BLAST
Experimental Design:
Cell line selection:
Use cancer cell lines with detectable baseline MRPL17 expression
For liver cancer studies: HepG2, Hep3B, Huh7
Include appropriate controls:
Non-targeting siRNA control
Mock transfection control
Untreated control
Knockdown Validation:
Confirm at mRNA level using qRT-PCR (24-48 hours post-transfection)
Verify at protein level using Western blotting with MRPL17 antibody (48-72 hours post-transfection)
Quantify knockdown efficiency by densitometry
Functional Analysis:
Mitochondrial function assessment:
Oxygen consumption rate
Mitochondrial membrane potential
ATP production
Cancer-related phenotypes:
Proliferation assays
Cell cycle analysis
Migration and invasion assays
Sphere formation assay (for cancer stem cell properties)
Rescue Experiments:
Generate an siRNA-resistant MRPL17 expression construct
Co-transfect with siRNA to demonstrate specificity of observed effects
Based on published research, MRPL17 knockdown would be expected to reduce cell proliferation and stem cell characteristics in liver cancer cells , potentially affecting pathways related to epithelial-mesenchymal transition as indicated by pathway enrichment analyses.
For effective multiplexed immunofluorescence incorporating MRPL17:
Panel Design:
Antibody selection:
Use primary antibodies from different host species when possible
Ensure antibodies are validated for immunofluorescence
Example MRPL17-focused panels:
Sequential Staining Protocol:
Perform heat-induced epitope retrieval
Block with appropriate serum
Apply primary MRPL17 antibody (1:100-1:500)
Detect with fluorophore-conjugated secondary antibody or tyramide signal amplification
If using tyramide amplification, perform antibody stripping while preserving fluorophore signal
Repeat cycles for additional targets
Counterstain with DAPI and mount with anti-fade medium
Imaging and Analysis:
Use multispectral imaging systems for accurate signal separation
Perform cell-by-cell quantification of marker expression
Analyze colocalization using appropriate statistical methods
Examine spatial relationships between differently labeled cells
Published research has successfully used multiplexed immunofluorescence to demonstrate elevated MRPL17 expression in liver hepatocellular carcinoma compared to normal liver tissue, as well as its correlation with Ki67 expression . This approach provides valuable spatial context for understanding MRPL17's relationships with other proteins in the tumor microenvironment.
For comprehensive multi-omics integration of MRPL17 data:
Data Collection Across Platforms:
Protein expression: Immunohistochemistry, Western blotting, proteomics
mRNA expression: qRT-PCR, RNA-seq, microarray
Epigenetic regulation: DNA methylation, chromatin accessibility
Functional readouts: Metabolomics, mitochondrial function assays
Integration Methods:
Correlation analyses between MRPL17 expression and:
Gene expression signatures (stemness, proliferation)
Metabolic pathway activities
Immune infiltration patterns
Machine learning approaches:
Visualization Techniques:
Create multi-omics heatmaps with samples clustered by MRPL17 expression
Generate network diagrams showing relationships between MRPL17 and other molecular features
Develop interactive dashboards for data exploration
Validation Approaches:
Test hypotheses generated from computational analyses in experimental models
Confirm findings across independent datasets
Validate clinically relevant associations in prospective studies
Research has demonstrated that integrative analyses incorporating MRPL17 can yield important insights into cancer biology. For example, computational analyses identified MRPL17 as the most critical gene for LIHC prognosis among 14 stem cell-related genes . Additionally, pathway analyses revealed associations between MRPL17 expression and tumor proliferation as well as epithelial-mesenchymal transition .