mrpl54 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to MRPL54 Antibody

MRPL54 is a nuclear-encoded protein integral to mitochondrial ribosomes, which synthesize mitochondrial DNA (mtDNA)-encoded subunits of the electron transport chain (ETC) . Antibodies targeting MRPL54 enable researchers to study its expression, localization, and role in mitochondrial function. These antibodies are critical for applications such as Western blot (WB), immunohistochemistry (IHC), and proteomic analyses .

Antibody Characteristics

Key specifications from commercial sources include:

ParameterThermo Fisher (PA5-54778)SAB Biotechnology
Host SpeciesRabbitRabbit
ClonalityPolyclonalPolyclonal
ApplicationsWB, IHCWB, IHC
ImmunogenSynthetic peptide (VLEYVVFEKQ...)Peptide from human MRPL54
Species ReactivityHuman, Mouse (88% identity)Human (Hu)
Molecular WeightNot specified~20 kDa
Gene ID84311 (Human)116541 (Human) / 66047 (Mouse)

Sources:

Research Findings

A 2023 Nature study investigated the effects of reduced MRPL54 expression using germline heterozygous Mrpl54 mice (Mrpl54+/−) . Key results include:

Metabolic and Physiological Outcomes

  • No significant differences in body composition, glucose tolerance, energy expenditure, or cardiac function between Mrpl54+/− and wild-type (WT) mice.

  • Female Mrpl54+/− mice exhibited increased ambulatory activity and treadmill endurance, potentially linked to lower body weight .

Lifespan Analysis

  • Median lifespan and maximum longevity were unchanged in Mrpl54+/− mice under standard housing conditions.

  • Individually housed male Mrpl54+/− mice showed a non-significant trend toward improved 24-month survival (HR 1.85, p = 0.12), suggesting stress mitigation in aggressive group-housed cohorts .

Mitochondrial Stress Response

  • No activation of the mitochondrial unfolded protein response (UPRmt) in liver tissue or primary myoblasts.

  • Reduced OXPHOS protein levels in myoblasts (e.g., MTCO1 and SDHB) without mitonuclear imbalance .

Technical Validation

  • Specificity: Both Thermo Fisher and SAB antibodies detect endogenous MRPL54 across species, with cross-reactivity confirmed in mouse (88% sequence identity) and human tissues .

  • Applications:

    • Western Blot: Used to identify MRPL54 at ~20 kDa in mitochondrial lysates .

    • Immunohistochemistry: Localizes MRPL54 to mitochondrial networks in tissue sections .

Functional Insights

  • Role in Translation: MRPL54 is essential for recruiting factors required for mitochondrial translation and ETC assembly .

  • Threshold Hypothesis: Partial MRPL54 reduction may not reach the stress threshold needed to activate UPRmt, unlike stronger perturbations (e.g., doxycycline-induced translation inhibition) .

Product Specs

Buffer
**Preservative:** 0.03% Proclin 300
**Constituents:** 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
mrpl54 antibody; si:dkeyp-70f9.5 antibody; 39S ribosomal protein L54 antibody; mitochondrial antibody; L54mt antibody; MRP-L54 antibody
Target Names
mrpl54
Uniprot No.

Target Background

Database Links
Subcellular Location
Mitochondrion.

Q&A

What is MRPL54 and what is its function in cellular biology?

MRPL54 (also known as L54mt or MRP-L54) is a 39S mitochondrial ribosomal protein that plays an essential role in mitochondrial protein synthesis. It is encoded by nuclear genes and transported to the mitochondria where it becomes part of the large ribosomal subunit (39S) of mitochondrial ribosomes (mitoribosomes) . These mitoribosomes are responsible for translating the 13 proteins encoded by mitochondrial DNA, which are critical components of the oxidative phosphorylation system.

Research on MRPL54 has shown that it may be involved in the regulation of mitochondrial function during aging and metabolic stress responses, though the specific mechanisms remain an active area of investigation .

What are the typical applications for MRPL54 antibodies in research?

MRPL54 antibodies serve multiple research purposes across various experimental platforms. The most common applications include:

  • Western Blotting (WB): For detecting and quantifying MRPL54 protein expression levels in tissue or cell lysates. The expected molecular weight of human MRPL54 is approximately 15-16 kDa .

  • Immunohistochemistry (IHC): For visualizing the distribution and localization of MRPL54 protein in tissue sections, which can be particularly useful for studying mitochondrial distribution in different cell types .

  • Immunofluorescence/Immunocytochemistry (IF/ICC): For examining subcellular localization of MRPL54 within intact cells, often used in co-localization studies with other mitochondrial markers .

  • ELISA: For quantitative detection of MRPL54 in biological samples, allowing for high-throughput screening .

  • Affinity Purification: For isolating MRPL54 and its interacting partners to study protein-protein interactions within the mitochondrial ribosome complex .

These applications provide researchers with versatile tools to investigate mitochondrial ribosome assembly, function, and the role of MRPL54 in various physiological and pathological conditions.

How should researchers validate the specificity of MRPL54 antibodies?

Validating antibody specificity is critical for ensuring reliable experimental results. For MRPL54 antibodies, researchers should implement the following validation approaches:

  • Positive and negative control samples: Use tissues or cell lines known to express MRPL54 (like muscle or cardiac tissue) as positive controls, and compare with tissues where expression is minimal or cells with MRPL54 knockdown/knockout as negative controls .

  • Peptide competition assay: Pre-incubate the antibody with the immunizing peptide before application to confirm that binding is specific to the target epitope, which should eliminate or significantly reduce signal detection .

  • Multiple antibody validation: Use different antibodies targeting various epitopes of MRPL54 to confirm consistent detection patterns .

  • Western blot analysis: Verify that the detected band appears at the expected molecular weight of approximately 15-16 kDa for human MRPL54 .

  • Cross-reactivity testing: If working with multiple species, confirm specificity across different organisms, as MRPL54 sequence conservation varies across species (human and mouse reactivity is often confirmed, with predicted reactivity in pig, bovine, sheep, and dog samples) .

Thorough validation ensures that experimental observations are truly related to MRPL54 and not artifacts from non-specific antibody binding.

How can MRPL54 antibodies be used to study mitochondrial stress responses and the mitochondrial unfolded protein response (UPRᵐᵗ)?

The mitochondrial unfolded protein response (UPRᵐᵗ) is a cellular stress response mechanism activated by mitochondrial dysfunction, and MRPL54 antibodies can be instrumental in studying this pathway. Research has shown that perturbing mitochondrial translation by modulating mitochondrial ribosomal proteins can trigger the UPRᵐᵗ and potentially impact lifespan in animal models .

When using MRPL54 antibodies to study UPRᵐᵗ activation, researchers should:

  • Establish baseline expression: Use western blotting with MRPL54 antibodies to quantify basal levels of MRPL54 in different tissues or cell types under normal conditions .

  • Analyze stress-induced changes: Compare MRPL54 levels before and after applying mitochondrial stressors (such as electron transport chain inhibitors, mtDNA depletion agents, or oxidative stress inducers) to examine how MRPL54 expression may be regulated during mitochondrial stress .

  • Co-immunoprecipitation studies: Use MRPL54 antibodies for pull-down assays to identify stress-induced changes in the composition of mitochondrial ribosomes or interaction partners that may emerge during UPRᵐᵗ activation .

  • Immunofluorescence co-localization: Combine MRPL54 antibodies with markers of UPRᵐᵗ activation (such as CHOP, ATF5, or HSP60) to visualize potential spatial reorganization of mitochondrial ribosomes during stress responses .

Recent research indicates that although reduced MRPL54 expression can decrease mitochondrial-encoded protein content, this alone may not be sufficient to activate significant UPRᵐᵗ or improve healthspan in otherwise healthy animals, suggesting that additional factors or stressors may be required for full response activation .

What methodological considerations are important when using MRPL54 antibodies for studying mitochondrial ribosome assembly?

Studying mitochondrial ribosome assembly requires careful methodological planning. When using MRPL54 antibodies for this purpose, researchers should consider:

  • Subcellular fractionation quality: Ensure pure mitochondrial isolation with minimal contamination from other cellular compartments. This typically involves differential centrifugation followed by density gradient purification of mitochondria .

  • Gentle lysis conditions: Use mild detergents (like digitonin or CHAPS) rather than harsh ionic detergents (like SDS) to preserve native ribosomal complexes when studying assembly intermediates .

  • Sucrose gradient analysis: Combine MRPL54 antibody detection with sucrose gradient fractionation to identify the incorporation of MRPL54 into assembly intermediates and mature ribosomes .

  • Native gel electrophoresis: Use blue native PAGE followed by immunoblotting with MRPL54 antibodies to analyze intact ribosomal complexes and assembly intermediates .

  • Crosslinking approaches: Implement protein crosslinking before immunoprecipitation with MRPL54 antibodies to capture transient interactions during assembly processes .

  • Quantitative considerations: When performing western blots, use appropriate loading controls specifically for mitochondrial content (like VDAC or TOM20) rather than general cellular proteins like GAPDH or actin .

These methodological refinements enable researchers to obtain more accurate and comprehensive information about how MRPL54 is incorporated into the mitochondrial ribosome and how this process may be altered under different physiological or pathological conditions.

How can researchers use MRPL54 antibodies to investigate the relationship between mitochondrial translation and aging?

Mitochondria have been implicated in the aging process since the 1970s, initially as sources of free radicals in the mitochondrial theory of aging and more recently as indicators of cellular aging through reduced respiratory chain efficiency . MRPL54 antibodies can be valuable tools for investigating these relationships through several methodological approaches:

  • Age-comparison studies: Use MRPL54 antibodies for western blotting and immunohistochemistry to compare protein levels in tissues from young versus aged animals or cell cultures. This can reveal whether MRPL54 expression changes with age and potentially contributes to altered mitochondrial translation efficiency .

  • Tissue-specific analysis: Apply immunohistochemistry with MRPL54 antibodies across different tissues to identify whether age-related changes in mitochondrial translation machinery exhibit tissue-specific patterns, particularly in post-mitotic tissues like heart, brain, and skeletal muscle that are most affected by mitochondrial dysfunction during aging .

  • Correlation with functional parameters: Combine MRPL54 immunodetection with functional assays such as mitochondrial oxygen consumption, ATP production, or respiratory complex activity to establish correlations between MRPL54 levels and functional outcomes .

  • Genetic manipulation validation: Use MRPL54 antibodies to validate knockdown or overexpression models designed to test hypotheses about mitochondrial translation in aging. For example, confirming reduced MRPL54 protein levels in heterozygous Mrpl54+/- mice used to study potential lifespan effects .

Research has shown that while lower mitochondrial ribosomal protein expression correlates with increased lifespan in some reference populations of mice, experimental reduction of MRPL54 expression alone did not significantly extend lifespan or improve healthspan measures in otherwise healthy mice . This suggests complex interactions between mitochondrial translation efficiency and aging that require careful experimental design and multiple analytical approaches.

What are common technical challenges when using MRPL54 antibodies and how can they be addressed?

Researchers often encounter several technical challenges when working with MRPL54 antibodies. Here are the most common issues and recommended solutions:

  • Low signal detection in western blotting:

    • Increase antibody concentration (typical working dilutions range from 1:500 to 1:2000)

    • Extend primary antibody incubation time to overnight at 4°C

    • Use enhanced chemiluminescence (ECL) substrates with higher sensitivity

    • Implement antigen retrieval techniques when processing samples

  • High background in immunostaining:

    • Increase blocking time or concentration (5% BSA or normal serum)

    • Add 0.1-0.3% Triton X-100 to antibody dilution buffer to reduce non-specific binding

    • Perform additional washing steps with gentle agitation

    • Pre-absorb antibody with tissue powder from a species different from the target

  • Inconsistent results between experiments:

    • Standardize lysate preparation methods, particularly considering that mitochondrial proteins may require specialized extraction protocols

    • Ensure consistent sample handling and storage conditions (-80°C is recommended for MRPL54 samples)

    • Prepare multiple aliquots of antibody to avoid freeze-thaw cycles that can affect antibody performance

    • Use internal controls in each experiment for normalization

  • Cross-reactivity with other mitochondrial ribosomal proteins:

    • Validate antibody specificity using MRPL54 knockout controls or siRNA knockdown samples

    • Perform peptide competition assays to confirm epitope specificity

    • Use gradient gels with high resolution for low molecular weight proteins to clearly separate MRPL54 (15 kDa) from other similar-sized mitochondrial ribosomal proteins

By systematically addressing these challenges, researchers can significantly improve the reliability and reproducibility of their MRPL54 antibody-based experiments.

How should researchers interpret conflicting results when studying MRPL54 expression across different experimental systems?

When researchers encounter conflicting results regarding MRPL54 expression or function across different experimental systems, several methodological approaches can help resolve these discrepancies:

  • Critical assessment of antibody validation: Different MRPL54 antibodies may target different epitopes, potentially leading to varied detection efficiency, especially if the protein undergoes post-translational modifications like the methylation documented at R115 . Researchers should:

    • Compare antibodies targeting different regions of MRPL54

    • Validate each antibody independently in each experimental system

    • Consider epitope accessibility in different sample preparation methods

  • Biological variation analysis: MRPL54 expression may naturally vary across:

    • Cell types and tissues (with higher expression expected in tissues with high mitochondrial content)

    • Developmental stages

    • Metabolic states

    • Species (despite sequence conservation, expression regulation may differ)

  • Methodological reconciliation approach:

    • Standardize protein extraction methods, particularly for mitochondrial proteins

    • Use multiple detection methods (e.g., complement antibody detection with mRNA quantification)

    • Normalize to appropriate loading controls specific to mitochondrial content

    • Consider absolute quantification approaches using recombinant MRPL54 standards

  • Functional correlation testing: When expression data conflicts, correlate with functional outcomes:

    • Measure mitochondrial translation rates using pulse-chase methods

    • Assess mitochondrial respiratory function

    • Evaluate mitochondrial ribosome assembly using gradient fractionation

Research on heterozygous MRPL54 mice has demonstrated that despite confirmed reduction in MRPL54 expression across multiple tissues, the physiological consequences were minimal in unstressed conditions . This suggests that experimental context, including presence of stressors or pre-existing mitochondrial dysfunction, may be critical factors affecting experimental outcomes and should be carefully controlled and reported.

What considerations are important when using MRPL54 antibodies for multi-species comparative studies?

Comparative studies across species can provide valuable evolutionary insights into mitochondrial ribosome function, but require careful methodological planning when using MRPL54 antibodies:

  • Species reactivity verification: Before conducting large-scale studies, perform preliminary validation:

    • MRPL54 antibodies typically show confirmed reactivity with human and mouse samples

    • Predicted reactivity may extend to pig, bovine, sheep, and dog samples, but requires verification

    • Sequence alignment analysis should be performed to identify the degree of conservation at the epitope region

  • Antibody selection strategy:

    • Choose antibodies raised against highly conserved regions of MRPL54 for multi-species studies

    • The amino acid sequence MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL represents the human MRPL54 , and regions of high conservation should be identified for antibody targeting

  • Sample preparation harmonization:

    • Standardize tissue collection, storage, and processing protocols across species

    • Adjust lysis conditions based on species-specific tissue characteristics

    • Consider using recombinant MRPL54 proteins from each species as positive controls

  • Cross-reactivity testing matrix:

    • Develop a systematic testing approach using tissue panels from each species

    • Create a cross-reactivity matrix documenting antibody performance across species

    • Include positive and negative controls for each species

  • Dilution optimization by species:

    • Optimal antibody dilutions may vary by species due to differences in epitope conservation

    • Typically starting dilutions range from 1:500-1:2000 for western blotting applications , but may need species-specific adjustment

When properly validated, MRPL54 antibodies can become valuable tools for evolutionary studies of mitochondrial translation machinery, potentially revealing insights into how mitochondrial ribosome composition and function have adapted across species with different metabolic demands and lifespans.

How might MRPL54 antibodies contribute to understanding mitochondrial disorders and developing therapeutic approaches?

MRPL54 antibodies have significant potential for advancing our understanding of mitochondrial disorders and supporting therapeutic development through several research avenues:

  • Diagnostic biomarker development: MRPL54 antibodies could be used to:

    • Assess mitochondrial ribosome integrity in patient samples

    • Develop immunodiagnostic assays for mitochondrial translation defects

    • Create tissue-specific profiles of mitochondrial ribosome composition in different disorders

  • Pathogenesis investigation: Researchers can employ MRPL54 antibodies to:

    • Track changes in mitochondrial ribosome assembly during disease progression

    • Identify whether MRPL54 levels are altered in specific mitochondrial disorders

    • Determine if MRPL54 becomes mislocalized in diseased tissues

  • Therapeutic response monitoring: As mitochondrial-targeted therapies develop, MRPL54 antibodies could:

    • Serve as markers for restoration of normal mitochondrial translation

    • Help quantify normalization of mitochondrial ribosome assembly

    • Assist in monitoring stress response pathway activation during treatment

  • Drug screening applications: For pharmaceutical development, MRPL54 antibodies might:

    • Support high-throughput screening of compounds that modulate mitochondrial translation

    • Help identify molecules that specifically target the mitochondrial ribosome

    • Aid in developing compounds that induce protective mitochondrial stress responses without causing damage

Research has shown that while reduced MRPL54 expression alone may not significantly extend lifespan, the protein remains an important component of mitochondrial translation machinery . Further investigation may reveal specific contexts where modulating MRPL54 and other mitochondrial ribosomal proteins could provide therapeutic benefit, particularly in conditions characterized by mitochondrial dysfunction.

What role might MRPL54 play in tissue-specific mitochondrial adaptation and how can researchers investigate this using available antibodies?

Mitochondria show remarkable tissue-specific adaptations that reflect the unique metabolic demands of different cell types. MRPL54 may contribute to these adaptations, and researchers can investigate this hypothesis using several methodological approaches with available antibodies:

  • Tissue expression profiling:

    • Use MRPL54 antibodies for immunohistochemistry and western blotting to create comprehensive tissue atlases of expression

    • Compare high-energy tissues (brain, heart, muscle) with lower-energy tissues

    • Investigate whether MRPL54 levels correlate with tissue-specific mitochondrial protein synthesis rates

  • Developmental dynamics investigation:

    • Track MRPL54 expression during tissue development and maturation

    • Correlate changes with mitochondrial biogenesis markers

    • Examine whether MRPL54 levels change during tissue-specific metabolic adaptations (e.g., muscle training, cold adaptation)

  • Stress response heterogeneity analysis:

    • Compare MRPL54 regulation across tissues during various stressors (oxidative stress, nutrient deprivation, hypoxia)

    • Determine if tissues differ in their mitochondrial translational response to identical stressors

    • Investigate whether MRPL54 participates in tissue-specific mitochondrial stress signaling

  • Ribosome specialization research:

    • Use MRPL54 antibodies for immunoprecipitation followed by mass spectrometry to identify tissue-specific interaction partners

    • Investigate whether post-translational modifications of MRPL54 (such as the documented methylation at R115) vary across tissues

    • Examine if MRPL54 association with other ribosomal components shows tissue-specific patterns

Research thus far has examined MRPL54 reduction in multiple tissues, finding that despite confirmed expression changes, physiological consequences were limited in unstressed conditions . This suggests that tissue context, including unique metabolic demands or pre-existing stress conditions, may be critical for determining how alterations in mitochondrial ribosomal proteins affect cellular function.

How can researchers integrate MRPL54 antibody-based techniques with emerging technologies for a more comprehensive understanding of mitochondrial translation?

The integration of traditional MRPL54 antibody techniques with cutting-edge technologies offers exciting opportunities for deeper insights into mitochondrial translation processes:

  • Single-cell analysis integration:

    • Combine MRPL54 immunofluorescence with single-cell RNA sequencing to correlate protein levels with transcriptional profiles

    • Use imaging mass cytometry with MRPL54 antibodies to map mitochondrial translation machinery across heterogeneous tissues

    • Implement proximity ligation assays to visualize MRPL54 interactions in individual cells

  • Live-cell imaging approaches:

    • Validate antibody-based findings using CRISPR-based tagging of endogenous MRPL54 for live imaging

    • Correlate antibody-detected MRPL54 levels with real-time measurements of mitochondrial translation using fluorescent reporters

    • Develop nanobody alternatives to conventional MRPL54 antibodies for improved live-cell applications

  • Spatial biology technology integration:

    • Apply MRPL54 antibodies in spatial transcriptomics platforms to correlate protein localization with regional gene expression

    • Use super-resolution microscopy with MRPL54 antibodies to examine nanoscale organization of mitochondrial ribosomes

    • Implement expansion microscopy to investigate mitochondrial ribosome distribution within mitochondrial subcompartments

  • Multi-omics experimental design:

    • Correlate MRPL54 antibody-based measurements with proteomics analysis of mitochondrial translation products

    • Integrate with mitochondrial metabolomics to link translation efficiency to metabolic outputs

    • Combine with mitochondrial DNA sequencing to understand how genetic variation influences translation machinery

  • High-throughput screening applications:

    • Develop MRPL54 antibody-based assays compatible with automated microscopy for screening genetic or pharmaceutical modulators of mitochondrial translation

    • Create reporter cell lines validated with MRPL54 antibodies for rapid assessment of mitochondrial translation efficiency

By thoughtfully integrating antibody-based approaches with these emerging technologies, researchers can develop a multidimensional understanding of how mitochondrial translation contributes to cellular function in health and disease, building upon existing knowledge of MRPL54's role in mitochondrial protein synthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.