MRPL49 Antibody

What applications are MRPL49 antibodies validated for?

MRPL49 antibodies have been extensively validated for multiple applications including Western Blot (WB), Immunoprecipitation (IP), Immunohistochemistry (IHC), and ELISA. Western blotting is the most commonly cited application, with at least 6 publications documenting successful use for this purpose . The antibodies show strong reactivity with human samples across these applications, with some citations also indicating reactivity in mouse models . For comprehensive studies, researchers can utilize the same antibody across multiple techniques to validate their findings.

When designing experiments, it's important to select an antibody with validation data for your specific application. The recommended dilutions vary by application with Western Blotting typically using 1:500-1:1000, Immunoprecipitation requiring 0.5-4.0 μg for 1.0-3.0 mg of total protein lysate, and Immunohistochemistry applications using 1:50-1:500 dilutions . Each of these applications reveals different aspects of MRPL49 expression and function within cellular contexts.

What cell lines and tissues are recommended for MRPL49 antibody validation?

Based on available validation data, BxPC-3, A549, and HeLa cells have been confirmed to yield positive results in Western Blot analyses with MRPL49 antibodies . For immunoprecipitation applications, HeLa cells have demonstrated consistent results . When performing immunohistochemistry, human breast cancer tissue has been successfully used with MRPL49 antibodies, with recommended antigen retrieval using TE buffer at pH 9.0 or alternatively with citrate buffer at pH 6.0 .

Researchers should consider using these validated cell lines and tissues as positive controls when first implementing MRPL49 antibody-based assays in their research. This approach helps establish baseline detection sensitivity and specificity before moving to experimental samples. Additionally, HL-60 cells have shown positive results with mitochondrial ribosomal protein antibodies of the related family (MRPL4), indicating potential cross-family validation strategies .

What are the optimal storage conditions for maintaining MRPL49 antibody activity?

MRPL49 antibodies are typically supplied in a stabilizing solution of PBS with 0.02% sodium azide and 50% glycerol at pH 7.3 . The recommended storage temperature is -20°C, where these antibodies remain stable for one year after shipment . For the specific product sizes that contain 0.1% BSA, it's worth noting that aliquoting is generally unnecessary for -20°C storage .

Proper storage is critical for maintaining antibody functionality and preventing degradation over time. Repeated freeze-thaw cycles can damage antibody structure and diminish recognition capacity, potentially leading to inconsistent experimental results. If extended storage or frequent use is anticipated, researchers might consider dividing the antibody into smaller working aliquots despite the general guidance that aliquoting isn't necessary. This approach minimizes exposure to room temperature conditions that can accelerate degradation of the antibody's binding capacity.

How should antigen retrieval be optimized for MRPL49 IHC applications?

When optimizing antigen retrieval for MRPL49 IHC applications, researchers should conduct initial comparative experiments using both buffer systems on identical tissue sections. Temperature and duration of heat-mediated antigen retrieval also require optimization, with typical protocols using either pressure cooking or microwave heating methods. Tissues with high fat content or those that have undergone prolonged fixation may require extended retrieval times. Additionally, researchers should include appropriate positive control tissues such as human breast cancer samples in optimization experiments to ensure the retrieval method effectively exposes MRPL49 epitopes without causing tissue degradation or introducing background staining .

What are the recommended approaches for resolving background issues in MRPL49 antibody applications?

Background issues in MRPL49 antibody applications can originate from multiple sources, including non-specific binding, cross-reactivity with similar epitopes, or endogenous peroxidase/phosphatase activity. To minimize these problems, researchers should implement a structured troubleshooting approach. First, optimize blocking steps using 5-10% normal serum from the same species as the secondary antibody or 3-5% BSA in PBS or TBS buffer for 1-2 hours at room temperature . Second, increase washing steps between antibody incubations, using at least three 5-minute washes with gentle agitation.

For Western blot applications specifically, background can be reduced by titrating the primary antibody concentration, with recommended dilutions between 1:500-1:1000 for MRPL49 antibodies . In immunohistochemistry applications, dilutions ranging from 1:50-1:500 have been validated, but optimal concentration should be determined empirically for each tissue type . Additionally, including 0.1-0.3% Triton X-100 in antibody dilution buffers may improve penetration while reducing non-specific membrane binding. If background persists despite these optimizations, pre-adsorption of primary antibodies with excess target protein or peptide can help confirm specificity, though this approach requires additional validation controls.

What controls should be included in MRPL49 antibody experiments?

Rigorous experimental design for MRPL49 antibody applications requires comprehensive controls to ensure data validity and reproducibility. Positive controls should include cell lines with confirmed MRPL49 expression such as BxPC-3, A549, or HeLa cells for Western blot applications . For immunohistochemistry, human breast cancer tissue serves as a reliable positive control . These controls establish detection sensitivity benchmarks and confirm proper experimental conditions.

Negative controls are equally important and should include: (1) omission of primary antibody while maintaining all other reagents and procedures; (2) substitution with isotype-matched control antibodies (rabbit IgG for MRPL49 polyclonal antibodies) ; and (3) when possible, MRPL49 knockout or knockdown samples. For advanced validation, researchers should consider siRNA knockdown of MRPL49 in positive control cell lines, which provides strong evidence of antibody specificity when detection is correspondingly diminished. Additionally, since MRPL49 is a mitochondrial protein, co-localization studies with established mitochondrial markers can provide further validation of proper subcellular localization detection. The inclusion of these controls allows researchers to distinguish specific from non-specific signals and provides confidence in the interpretation of experimental results.

How do MRPL49 antibodies perform in mitochondrial ribosome complex studies?

MRPL49 antibodies have demonstrated value in investigating mitochondrial ribosome complexes through various protein-protein interaction studies. Research indicates that MRPL49 antibodies can be effectively used alongside other mitoribosomal antibodies such as MRPL3 and MRPS22 to study the assembly and function of mitochondrial ribosomes . In co-immunoprecipitation experiments, MRPL49 antibodies have successfully pulled down associated mitoribosomal proteins, providing insights into the structural organization of these important cellular machinery components.

When designing experiments to study mitochondrial ribosome complexes, researchers should consider using a combination of detergents that maintain native protein interactions while allowing sufficient solubilization of membrane-associated complexes. Crosslinking approaches prior to immunoprecipitation can capture transient interactions within the ribosomal assembly. Mass spectrometry analysis following MRPL49 immunoprecipitation has identified numerous interacting partners, highlighting the central role of this protein in mitochondrial translation processes . Additionally, researchers investigating mitochondrial RNA granules should note the critical dependence of these structures on mitochondrial DNA, with MRPL49 serving as an important marker in these studies .

What approaches are recommended for distinguishing MRPL49 from other mitochondrial ribosomal proteins?

The mitochondrial ribosomal protein family includes numerous members with similar structural features, creating potential specificity challenges for antibody-based detection. When designing experiments to specifically target MRPL49, researchers should implement multiple approaches to ensure accurate identification. First, western blot analysis should confirm detection at the expected 19 kDa molecular weight, which matches both calculated and observed sizes for MRPL49 . This contrasts with other family members like MRPL4, which has a molecular weight of approximately 35-36 kDa .

For advanced specificity verification, epitope mapping can be performed to confirm the antibody recognizes the specific immunogen sequence used for MRPL49 antibody generation. Some commercially available antibodies, such as HPA046778, target the specific peptide sequence "GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF" , which can be used for blocking peptide controls. Additionally, mass spectrometry validation following immunoprecipitation provides the highest level of confidence in protein identification. This approach has successfully distinguished MRPL49 from other mitoribosomal proteins in complex samples . Finally, dual-label immunofluorescence with antibodies against different mitochondrial ribosomal proteins can help establish the distinct localization patterns of MRPL49 within mitochondrial substructures.

How can MRPL49 antibodies be used in mitochondrial dysfunction research?

MRPL49 antibodies offer valuable tools for investigating mitochondrial dysfunction across various disease models. As a component of mitochondrial ribosomes, MRPL49 plays a crucial role in the translation of mitochondrially-encoded proteins essential for respiratory chain function. Researchers can utilize MRPL49 antibodies to assess alterations in mitochondrial ribosome composition and abundance in conditions associated with mitochondrial dysfunction, including neurodegenerative diseases, cancer, and metabolic disorders.

In cancer research specifically, MRPL49 antibodies have been applied to breast cancer tissue samples using immunohistochemistry , potentially revealing altered expression patterns associated with metabolic reprogramming in tumor cells. For neurodegenerative disease models, quantitative western blotting with MRPL49 antibodies can detect changes in mitochondrial ribosome abundance that may precede functional deficits in oxidative phosphorylation. When combining MRPL49 detection with assays for mitochondrial RNA granules, researchers gain insights into the coordinated processes of RNA processing and protein synthesis within mitochondria . Furthermore, the relationship between mitochondrial ribosome function and the mitochondrial unfolded protein response can be explored through simultaneous detection of MRPL49 and stress response proteins, providing mechanistic insights into how cells adapt to mitochondrial dysfunction.

How should researchers address inconsistent MRPL49 antibody staining patterns?

Inconsistent staining patterns with MRPL49 antibodies can result from various technical and biological factors that require systematic troubleshooting. First, ensure consistent sample preparation, including standardized fixation protocols (both fixative type and duration) for tissue samples or identical lysis conditions for cell samples. For immunohistochemistry applications, the antigen retrieval method significantly impacts epitope accessibility, with MRPL49 antibodies showing optimal results using TE buffer at pH 9.0, though citrate buffer at pH 6.0 can serve as an alternative .

Antibody dilution represents another critical parameter, with recommended ranges of 1:500-1:1000 for Western blot and 1:50-1:500 for immunohistochemistry applications . Performing a dilution series can help identify the optimal concentration for specific sample types. Additionally, mitochondrial proteins like MRPL49 may show variable staining intensity based on the metabolic state of cells or tissues, reflecting genuine biological variability rather than technical artifacts. To distinguish between these possibilities, researchers should include metabolically standardized control samples alongside experimental tissues. Finally, batch-to-batch variation in antibody production can influence staining consistency, making it advisable to reserve sufficient antibody from a single lot for complete experimental series when possible.

What methodological approaches are recommended for studying MRPL49 in different species?

While MRPL49 antibodies have primarily been validated with human samples, there are citations indicating reactivity with mouse samples as well . When extending research to different species, researchers should implement a staged validation approach. Begin with sequence homology analysis between human MRPL49 and the target species to predict potential cross-reactivity. For the antibody targeting the immunogen sequence "GKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF" , species with high sequence conservation in this region are more likely to show successful cross-reactivity.

Initial validation in new species should employ multiple detection methods. Western blotting can confirm detection at the expected molecular weight, while immunoprecipitation followed by mass spectrometry provides definitive identification. For immunohistochemistry or immunofluorescence in new species, researchers should test multiple antigen retrieval methods and antibody concentrations, as optimal conditions may differ from those established for human samples. Additionally, including tissues from knockout models (where available) provides the strongest negative control validation. When studying MRPL49 across species, researchers should be aware that mitochondrial ribosome composition shows evolutionary divergence, potentially affecting interaction partners and functional assays even when the antibody successfully detects the protein target.

How can mass spectrometry complement MRPL49 antibody-based studies?

Mass spectrometry offers powerful complementary approaches to antibody-based detection of MRPL49, particularly for validating specificity and identifying interaction partners. Following immunoprecipitation with MRPL49 antibodies, nanoLC coupled to Q Exactive hybrid quadrupole-Orbitrap mass spectrometry can provide definitive protein identification and quantification . This approach typically employs C18 chromatography with a linear gradient of acetonitrile containing 0.1% formic acid for optimal peptide separation prior to mass analysis .

For researchers investigating MRPL49's role in mitochondrial ribosome assembly, immunoprecipitation followed by mass spectrometry can identify the complete complement of interacting proteins, revealing both established and novel associations. This technique has successfully identified other mitoribosomal proteins (including MRPL3 and MRPS22) as MRPL49 interaction partners . Beyond protein identification, advanced mass spectrometry approaches can detect post-translational modifications on MRPL49 that may regulate its function or interactions. Additionally, targeted multiple reaction monitoring (MRM) mass spectrometry can provide absolute quantification of MRPL49 across different samples or conditions, offering a complementary approach to relative quantification by Western blotting. Researchers combining these orthogonal techniques gain higher confidence in their findings regarding MRPL49 expression, localization, and function in various experimental contexts.

What are the recommended dilutions for different MRPL49 antibody applications?

The optimal dilution of MRPL49 antibodies varies by application type and specific experimental conditions. Based on validated protocols, the following dilution ranges are recommended:

These recommended dilutions serve as starting points for optimization. Researchers should titrate antibodies for their specific samples and detection systems to achieve optimal signal-to-noise ratios. For novel applications or sample types, a broader dilution series is advisable during initial optimization experiments. Additionally, validation in at least one established positive control sample should precede experimental applications to confirm antibody performance under laboratory-specific conditions.

What are the key characteristics of available MRPL49 antibodies?

Several MRPL49 antibodies are commercially available with distinct characteristics relevant to research applications:

When selecting an antibody for specific research applications, researchers should consider the validation data available for each product in their intended application and experimental system. The fusion protein-derived antibody (15542-1-AP) offers broader application validation, while the peptide-specific antibody (HPA046778) may provide more targeted epitope recognition. Additionally, researchers should note that MRPL49 is also known by several alternative names including C11orf4, NOF1, L49mt, and SW-cl.67, which may be referenced in literature or product descriptions .