RPS13A Antibody

What is RPS13 and why is it significant in research?

RPS13 (Ribosomal Protein S13) is a component of the small (40S) ribosomal subunit and belongs to the Universal ribosomal protein uS15 family. In humans, it consists of 151 amino acid residues with a molecular mass of 17.2 kDa . RPS13 is significant in research due to its essential role in protein synthesis and ribosome assembly. Researchers often use RPS13 antibodies to study ribosome biogenesis, translation mechanisms, and ribosome-related pathologies. The protein is highly conserved across species, making it valuable for comparative studies in different model organisms .

What are the common synonyms and orthologs for RPS13?

When searching literature and databases, researchers should be aware of multiple nomenclatures:

RPS13 gene orthologs have been reported in multiple species including mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken, making it valuable for comparative studies . When selecting antibodies, confirm cross-reactivity with your species of interest.

Where is RPS13 protein localized in cells?

RPS13 exhibits dual subcellular localization in both the nucleus and cytoplasm . In the nucleus, it participates in ribosome assembly, while in the cytoplasm, it functions as part of the mature ribosome in protein synthesis. This dual localization makes it particularly useful for studying nucleo-cytoplasmic transport of ribosomal components. When using immunofluorescence techniques, researchers should expect to observe both nuclear and cytoplasmic staining patterns. Proper sample preparation is critical to preserve both localization sites when using RPS13 antibodies for subcellular localization studies.

How do I select the appropriate RPS13 antibody for my specific research application?

Selection criteria should include:

• Epitope specificity: Consider whether you need antibodies targeting specific regions. For example, N-terminal specific antibodies recognize the region with amino acids MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI , while others target regions like amino acids 71-120 .

• Validated applications: Confirm the antibody has been validated for your specific application. Common applications include Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-Linked Immunosorbent Assay (ELISA), and Flow Cytometry (FCM) .

• Species reactivity: Verify cross-reactivity with your experimental organism. Most commercially available RPS13 antibodies react with human, mouse, and rat, but some offer broader reactivity including zebrafish, bovine, dog, guinea pig, horse, chicken, and xenopus .

• Clonality: Choose between polyclonal (broader epitope recognition) and monoclonal (single epitope specificity) based on your experimental needs.

What are the recommended protocols for using RPS13 antibodies in Western blotting?

For optimal Western blot results with RPS13 antibodies:

• Sample preparation: Use RIPA or NP-40 lysis buffers with protease inhibitors to extract both nuclear and cytoplasmic proteins.

• Gel separation: Use 12-15% polyacrylamide gels to properly resolve the ~17 kDa protein.

• Antibody dilution: Start with dilutions of 1:500 - 1:2000 for Western blotting applications . Optimize by testing several dilutions.

• Blocking: Use 5% non-fat milk or BSA in TBST for 1 hour at room temperature.

• Expected results: While the calculated molecular weight is 17.2 kDa, some antibodies may detect a band at approximately 72 kDa , which may represent post-translationally modified forms or protein complexes. Always include positive controls to confirm specificity.

How should I optimize immunohistochemistry protocols with RPS13 antibodies?

For successful immunohistochemistry:

• Fixation: 4% paraformaldehyde is generally suitable for preserving both nuclear and cytoplasmic localization.

• Antigen retrieval: Heat-induced epitope retrieval using citrate buffer (pH 6.0) is recommended.

• Antibody dilution: Begin with a 1:100 - 1:300 dilution for IHC applications and optimize as needed.

• Incubation: Overnight incubation at 4°C typically yields the best signal-to-noise ratio.

• Detection system: Both ABC and polymer-based detection systems work well with RPS13 antibodies.

• Controls: Include tissues known to express RPS13 (most proliferating tissues) as positive controls and perform secondary-only controls to assess background.

Why might I observe a molecular weight for RPS13 different from the predicted 17.2 kDa?

This discrepancy is a common challenge in RPS13 detection. While the calculated molecular weight is 17.2 kDa, observed weights may vary:

To address this:

• Use denaturing conditions with both SDS and reducing agents

• Include positive control lysates

• Perform peptide competition assays to confirm specificity

• Consider using antibodies targeting different epitopes to compare results

How can I verify the specificity of my RPS13 antibody?

Verifying antibody specificity is crucial for reliable results:

• Peptide competition: Pre-incubate the antibody with the immunizing peptide. Specific signals should disappear.

• siRNA knockdown: Compare staining/bands between normal and RPS13-knockdown samples.

• Multiple antibodies: Use antibodies targeting different epitopes of RPS13 and compare recognition patterns.

• Mass spectrometry: Confirm identity of immunoprecipitated proteins or bands from Western blots.

• Recombinant protein: Use purified recombinant RPS13 as a positive control.

These validation approaches should be documented in your experimental methods when publishing results.

What explains cross-reactivity of RPS13 antibodies with other proteins?

Cross-reactivity may occur due to:

• Conserved domains: RPS13 belongs to the uS15 protein family, which has conserved domains across multiple proteins.

• Epitope similarity: Short amino acid sequences used as immunogens may share homology with other proteins.

• Post-translational modifications: Some antibodies may preferentially recognize modified forms of the protein.

To minimize cross-reactivity:

• Select antibodies raised against unique regions of RPS13

• Increase stringency in washing steps

• Optimize antibody dilutions to reduce non-specific binding

• Consider affinity-purified antibodies specifically tested for cross-reactivity

How can RPS13 antibodies be used to study ribosome biogenesis?

RPS13 antibodies enable sophisticated studies of ribosome assembly:

• Immunoprecipitation coupled with mass spectrometry: Identify RPS13 interaction partners during ribosome assembly.

• Chromatin immunoprecipitation (ChIP): Study association of RPS13 with ribosomal DNA or processing factors.

• Pulse-chase experiments: Track newly synthesized RPS13 incorporation into ribosomes using immunoprecipitation after metabolic labeling.

• Proximity ligation assay (PLA): Visualize interactions between RPS13 and other ribosomal proteins or assembly factors in situ.

• Immunofluorescence combined with RNA FISH: Co-localize RPS13 with ribosomal RNA precursors to study assembly dynamics.

What approaches can be used to study RPS13 protein interactions?

Several methodologies can reveal RPS13 protein interactions:

When analyzing ribosomal complexes, consider using specialized buffers containing magnesium to maintain ribosome integrity during extraction.

How do post-translational modifications affect RPS13 antibody recognition?

Post-translational modifications (PTMs) can significantly impact antibody binding:

• Phosphorylation: RPS13 can be phosphorylated at multiple sites, potentially affecting antibody recognition. Phosphatase treatment of samples before Western blotting can determine if your antibody is sensitive to phosphorylation status.

• Ubiquitination: Can result in higher molecular weight bands. Use deubiquitinating enzymes to confirm.

• Methylation: Common in ribosomal proteins and may affect epitope accessibility.

For comprehensive analysis, consider using modification-specific antibodies alongside total RPS13 antibodies. Alternatively, immunoprecipitate RPS13 and analyze PTMs by mass spectrometry.

What considerations should be made when studying RPS13 in disease models?

When investigating RPS13 in pathological contexts:

• Expression levels: Many diseases feature dysregulated ribosome biogenesis. Quantify RPS13 levels relative to other ribosomal proteins using multiple techniques.

• Cellular localization: Changes in nucleolar structure or nucleo-cytoplasmic transport can alter RPS13 distribution. Use fractionation protocols followed by Western blotting or high-resolution imaging.

• Incorporation into ribosomes: Not all expressed RPS13 is incorporated into functional ribosomes. Use sucrose gradient fractionation to distinguish free versus ribosome-incorporated RPS13.

• Turnover rate: Pulse-chase experiments with RPS13 antibodies can reveal altered protein stability in disease states.

• Disease-specific modifications: Some pathologies may feature unique PTMs. Mass spectrometry following immunoprecipitation can identify disease-specific modifications.

How can RPS13 antibodies be integrated with modern single-cell analysis techniques?

Emerging applications include:

• Single-cell Western blotting: Quantify RPS13 expression heterogeneity within cell populations.

• Mass cytometry (CyTOF): Use metal-conjugated RPS13 antibodies for high-dimensional analysis at single-cell resolution.

• Imaging mass cytometry: Visualize RPS13 distribution in tissue sections with subcellular resolution alongside dozens of other markers.

• CODEX multiplexed imaging: Perform iterative antibody staining to visualize RPS13 in spatial context with numerous other proteins.

These techniques allow researchers to correlate RPS13 expression with cellular states in heterogeneous samples like tumors or developing tissues.

What are methodological considerations for using RPS13 antibodies in ribosome profiling studies?

When incorporating antibodies into ribosome profiling workflows:

• Immunoprecipitation before profiling: Use RPS13 antibodies to isolate specific ribosome populations before RNA extraction and sequencing.

• Validation of ribosome integrity: Confirm that immunoprecipitation with RPS13 antibodies yields intact ribosomes by analyzing rRNA content.

• Translating vs. non-translating pools: Combine with puromycin labeling to distinguish actively translating ribosomes.

• Cross-validation: Compare results from RPS13 immunoprecipitation with traditional sucrose gradient approaches.

Careful optimization of immunoprecipitation conditions is essential to maintain the association of mRNAs with ribosomes during the procedure.

How can computational approaches enhance RPS13 antibody-based research?

Computational methods can maximize data extracted from RPS13 antibody experiments:

• Epitope prediction algorithms: Identify optimal regions for raising new, highly specific antibodies.

• Image analysis pipelines: Quantify subcellular distribution patterns in immunofluorescence using machine learning approaches.

• Network analysis: Integrate RPS13 interactome data with transcriptomics and proteomics datasets to reveal functional relationships.

• Structural modeling: Predict how antibody binding might affect RPS13 function within the ribosome structure.

These computational approaches can help address fundamental questions about ribosome heterogeneity and specialized functions that aren't accessible through standard methods alone.