RPS13B Antibody

Shipped with Ice Packs
In Stock

Description

Overview of RPS13 Antibody

RPS13 (ribosomal protein S13) is a component of the 40S ribosomal subunit involved in protein synthesis. It belongs to the S15P ribosomal protein family and is conserved across eukaryotes . Antibodies targeting RPS13 are widely used to study ribosomal biogenesis, translational regulation, and cancer biology .

Western Blot (WB)

  • Observed Molecular Weight: ~14–17 kDa (discrepancy due to post-translational modifications) .

  • Recommended Dilutions:

    • Proteintech: 1:1000–1:4000

    • Boster Bio: 1:500–1:2000

  • Key Findings:

    • RPS13 binds 5.8S rRNA and is implicated in ribosome assembly .

    • Overexpression observed in multidrug-resistant gastric cancer cells .

Immunohistochemistry (IHC)

  • Dilution Range: 1:50–1:500 (Proteintech) .

  • Antigen Retrieval: TE buffer (pH 9.0) or citrate buffer (pH 6.0) for human colon cancer tissue .

Immunofluorescence (IF)

  • Localizes to cytoplasmic and nuclear bodies in HeLa and HEK 293 cells .

Antibody Validation and Quality Control

  • Proteintech: Validated in WB (MCF-7 cells, rodent tissues), IHC (colon cancer), and IF (HeLa cells) .

  • Boster Bio: Specificity confirmed via ELISA, WB, and IHC with Boster’s guarantee .

  • Novus/Bio-Techne: Includes Western blot data using THP-1 lysate .

Key Research Findings

  • Role in Cancer: RPS13 antibodies identified elevated expression in gastric cancer multidrug-resistant cells (SGC7901/VCR), suggesting a role in chemoresistance .

  • Circadian Regulation: RPS13 interacts with translational machinery linked to circadian clock modulation .

  • Ribosome Stalling: RPS13 is part of an E3 ligase network that degrades stalled ribosomes .

Limitations and Notes

  • Species Reactivity: Most antibodies target human, mouse, and rat. Cross-reactivity with zebrafish, cow, and yeast is predicted but less validated .

  • Nomenclature Alert: No commercial or peer-reviewed sources mention "RPS13B" in the provided data. Confirm gene/protein naming conventions for your organism of interest.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Composition: 50% Glycerol, 0.01M PBS, pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
RPS13B antibody; At4g00100 antibody; F6N15.7 antibody; 40S ribosomal protein S13-2 antibody
Target Names
RPS13B
Uniprot No.

Q&A

What is RPS13 and why are antibodies against it valuable in research?

RPS13 (ribosomal protein S13) is a component of the 40S ribosomal subunit involved in protein synthesis. It is located in the cytoplasm and has the unique feature of being co-transcribed with two U14 small nucleolar RNA genes, which are located in its third and fifth introns . Antibodies against RPS13 are valuable research tools for studying ribosome biogenesis, protein synthesis, and cellular stress responses. These antibodies allow researchers to track RPS13 expression levels, localization patterns, and interactions with other proteins, providing insights into both normal cellular processes and disease mechanisms where ribosomal function may be compromised .

What are the key specifications to consider when selecting an RPS13 antibody?

When selecting an RPS13 antibody, researchers should consider several critical specifications:

  • Validated reactivity: Confirm the antibody has been tested against your species of interest. Most commercial RPS13 antibodies show reactivity with human samples, with some also validated for mouse and rat samples .

  • Applications compatibility: Verify the antibody has been validated for your specific application (WB, IHC, IF/ICC) .

  • Clonality: Determine whether a polyclonal or monoclonal antibody best suits your research needs. Polyclonal antibodies often provide higher sensitivity but potentially lower specificity .

  • Immunogen sequence: Consider the epitope region the antibody recognizes. For example, some antibodies target middle regions of RPS13 with specific peptide sequences like "ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES" .

  • Molecular weight detection: Verify the antibody detects the correct molecular weight. RPS13 has a theoretical MW of 17 kDa but is sometimes observed at 14 kDa or 19 kDa (for recombinant tagged versions) .

  • Validation data: Review available validation data including Western blots, IHC images, and specificity testing .

What are the common applications for RPS13 antibodies?

RPS13 antibodies support multiple research applications, each requiring specific optimization:

ApplicationCommon DilutionsPositive ControlsSpecial Considerations
Western Blot1:1000-1:4000MCF-7 cells, mouse/rat uterus tissueOften detects bands at 14 kDa and 17 kDa
Immunohistochemistry1:50-1:500Human colon cancer tissueOptimal with TE buffer pH 9.0 for antigen retrieval
Immunofluorescence1:50-1:500HeLa cellsEthanol fixation (-20°C) recommended
ELISAVaries by kit---Used primarily for antibody validation

These applications have been validated across multiple sources, with Western blot being the most commonly cited technique in the literature .

What is the optimal protocol for Western blot detection of RPS13?

For optimal Western blot detection of RPS13, the following methodological approach is recommended:

  • Sample preparation: Prepare cell or tissue lysates in RIPA buffer supplemented with protease inhibitors. For tissues, homogenization in cold buffer followed by centrifugation is essential.

  • Protein quantification: Use Bradford or BCA assay to ensure equal loading (typically 20-30μg total protein).

  • Gel selection: Use 12-15% SDS-PAGE gels due to RPS13's low molecular weight (17 kDa theoretical, often observed at 14 kDa) .

  • Transfer conditions: Transfer to PVDF membrane using semi-dry transfer (15V for 30 minutes) or wet transfer (100V for 60 minutes).

  • Blocking: Block membranes with 5% non-fat milk in TBST for 1 hour at room temperature.

  • Primary antibody: Dilute RPS13 antibody between 1:1000-1:4000 in blocking buffer and incubate overnight at 4°C .

  • Detection: After washing, use HRP-conjugated secondary antibodies (typically 1:5000) and ECL detection. Expect bands at approximately 14-17 kDa .

  • Controls: Include positive controls like MCF-7 cell lysate to verify antibody performance .

This protocol has been validated across multiple studies and ensures specific detection of endogenous RPS13 protein.

How should immunohistochemistry protocols be optimized for RPS13 detection in tissue sections?

Optimizing immunohistochemistry protocols for RPS13 detection requires attention to several critical factors:

  • Fixation: Use 10% neutral buffered formalin fixation for 24-48 hours, followed by paraffin embedding using standard protocols.

  • Sectioning: Cut tissue sections at 4-5μm thickness and mount on positively charged slides.

  • Antigen retrieval: This is crucial for RPS13 detection. Use TE buffer pH 9.0 for heat-mediated antigen retrieval (recommended as primary method). Alternatively, citrate buffer pH 6.0 may be used, though potentially with reduced signal intensity .

  • Blocking: Block endogenous peroxidase with 3% H₂O₂, followed by serum blocking (5-10% normal serum from secondary antibody species).

  • Primary antibody: Dilute RPS13 antibody 1:50-1:500 in antibody diluent and incubate at 4°C overnight or at room temperature for 1-2 hours .

  • Detection system: Use polymer-HRP detection systems for improved sensitivity with minimal background.

  • Counterstaining: Counterstain with hematoxylin, followed by bluing in ammonia water.

  • Positive control: Human colon cancer tissue has shown consistent positive staining and serves as an effective control .

This optimized protocol enhances detection sensitivity while minimizing background, allowing for accurate visualization of RPS13 in tissue sections.

What are the critical factors for successful immunofluorescence detection of RPS13?

For successful immunofluorescence detection of RPS13, researchers should focus on these critical factors:

  • Cell preparation: Culture cells on coverslips or chamber slides at 60-70% confluency to allow proper visualization of subcellular structures.

  • Fixation method: Ethanol fixation at -20°C provides optimal results for RPS13 detection, preserving its cytoplasmic localization pattern .

  • Permeabilization: If using paraformaldehyde fixation instead, permeabilize with 0.1-0.5% Triton X-100 for 5-10 minutes.

  • Blocking: Block with 1-5% BSA or normal serum in PBS for 30-60 minutes at room temperature.

  • Primary antibody: Dilute RPS13 antibody 1:50-1:500 in blocking buffer and incubate overnight at 4°C or 1-2 hours at room temperature .

  • Secondary antibody: Use fluorophore-conjugated secondary antibodies (Alexa Fluor 488/594/647) at 1:500-1:1000 dilution.

  • Nuclear counterstaining: Counterstain nuclei with DAPI (1μg/ml) for 5 minutes.

  • Mounting: Mount using anti-fade mounting medium to prevent photobleaching.

  • Controls: Include a negative control (secondary antibody only) and a positive control (HeLa cells show consistent RPS13 expression) .

This approach allows for precise visualization of RPS13's cytoplasmic distribution and potential colocalization with other cellular components.

How can RPS13 antibodies be used to investigate ribosome biogenesis defects?

RPS13 antibodies offer valuable tools for investigating ribosome biogenesis defects through several advanced approaches:

  • Nucleolar stress analysis: During nucleolar stress, RPS13 localization patterns change. Using immunofluorescence with RPS13 antibodies can reveal abnormal distribution patterns that indicate compromised ribosome assembly.

  • Pre-ribosomal particle composition: Immunoprecipitation with RPS13 antibodies followed by mass spectrometry analysis can identify abnormal protein associations in pre-ribosomal particles under different stress conditions or disease states.

  • Ribosome profiling: Western blot analysis of polysome fractions using RPS13 antibodies can reveal abnormal incorporation into 40S subunits or mature ribosomes, indicating assembly defects.

  • Pulse-chase experiments: Combining metabolic labeling of newly synthesized RNA with RPS13 immunoprecipitation can track the kinetics of RPS13 incorporation into ribosomes, which is often delayed in biogenesis disorders.

  • Tissue-specific expression patterns: IHC analysis across different tissues can identify tissue-specific variations in RPS13 expression that may correlate with tissue-specific ribosomopathies .

These approaches help elucidate the molecular mechanisms underlying ribosomopathies and cancer-associated ribosome defects, providing potential therapeutic targets.

What strategies can resolve discrepancies in RPS13 detection between different antibodies?

When facing discrepancies in RPS13 detection between different antibodies, researchers should implement the following systematic validation approach:

  • Epitope mapping comparison: Compare the immunogen sequences of different antibodies. Those recognizing different regions of RPS13 may show varying detection patterns. For example, antibodies targeting the middle region (amino acids approximately 40-90) versus N-terminal regions may produce different results .

  • Knockout/knockdown validation: Use CRISPR/Cas9 knockout or siRNA knockdown of RPS13 to confirm antibody specificity. All valid antibodies should show reduced or absent signal in these systems.

  • Recombinant protein controls: Test antibodies against purified recombinant RPS13 protein (both tagged and untagged versions) to confirm direct recognition .

  • Cross-reactivity testing: Perform peptide competition assays with immunogen peptides to confirm specificity.

  • Multiple detection methods: Compare results across different techniques (WB, IF, IHC) to identify technique-specific issues.

  • Sample preparation variations: Test multiple fixation methods, antigen retrieval conditions, and buffer systems to optimize detection conditions for each antibody.

  • Secondary antibody optimization: Test different detection systems and secondary antibodies to rule out secondary antibody-related issues.

Through this systematic approach, researchers can resolve discrepancies and select the most appropriate antibody for their specific experimental conditions.

How can RPS13 antibodies contribute to cancer research?

RPS13 antibodies provide valuable tools for cancer research, offering insights into several critical aspects of cancer biology:

  • Biomarker identification: IHC staining patterns in tumor tissues can help identify altered RPS13 expression as potential diagnostic or prognostic biomarkers. Particularly relevant in gastric cancer, where RPS13 has shown differential expression patterns .

  • Drug resistance mechanisms: Using Western blot analysis to monitor RPS13 expression in chemoresistant cell lines can reveal its potential role in multidrug resistance, as suggested by its elevated expression in SGC7901/VCR gastric cancer cells .

  • Cancer-specific translation programs: Immunoprecipitation of RPS13-containing ribosomes followed by RNA-seq (ribosome profiling) can identify cancer-specific translated mRNAs, revealing specialized translation programs in cancer cells.

  • Stress response pathways: Monitoring RPS13 localization changes during cellular stress responses (using IF/ICC) can elucidate how cancer cells adapt to therapeutic interventions.

  • Response to ribosome-targeting therapies: Western blot monitoring of RPS13 levels during treatment with ribosome-targeting drugs can help determine efficacy and resistance mechanisms.

  • Protein-protein interaction networks: Co-immunoprecipitation with RPS13 antibodies followed by mass spectrometry can identify cancer-specific protein interaction networks involving ribosomal components.

These applications help elucidate the broader role of ribosomal proteins in cancer initiation, progression, and therapeutic response, potentially leading to novel intervention strategies .

What are common issues in RPS13 antibody applications and how can they be resolved?

Researchers frequently encounter several challenges when working with RPS13 antibodies:

IssuePossible CausesSolutions
Multiple bands in Western blotPost-translational modifications, degradation products, or cross-reactivityUse freshly prepared samples with protease inhibitors; optimize antibody dilution (1:2000-1:4000); include blocking peptide controls; consider different lysis buffers
Weak or no signal in IHCInadequate antigen retrieval, overfixation, or suboptimal antibody concentrationOptimize antigen retrieval using TE buffer pH 9.0; try longer primary antibody incubation (overnight at 4°C); use amplification detection systems; reduce fixation time
High background in IFInsufficient blocking, excessive antibody concentration, or autofluorescenceIncrease blocking time/concentration; optimize antibody dilution (start at 1:100); include 0.1% Triton X-100 in washing buffers; use Sudan Black to reduce autofluorescence
Inconsistent results between experimentsAntibody degradation, variable sample quality, or protocol inconsistencyAliquot antibodies to avoid freeze-thaw cycles; standardize sample preparation; develop detailed step-by-step protocols with critical parameters specified
Discrepancy between observed and predicted MWPost-translational modifications, splice variants, or gel system artifactsUse gradient gels; include molecular weight markers close to 17 kDa; compare results with positive control lysates (e.g., MCF-7 cells)

Implementing these solutions systematically will improve reliability and reproducibility in RPS13 antibody applications across different experimental systems.

What considerations are important when using RPS13 antibodies for co-localization studies?

When using RPS13 antibodies for co-localization studies, several important considerations must be addressed:

  • Antibody compatibility: Ensure primary antibodies against RPS13 and the co-target protein are raised in different host species (e.g., rabbit anti-RPS13 and mouse anti-nucleolin) to allow simultaneous detection with species-specific secondary antibodies .

  • Fixation optimization: Different proteins may require different optimal fixation methods. Test whether the ethanol fixation recommended for RPS13 (-20°C) is compatible with preserving the structure and antigenicity of your co-target protein .

  • Signal intensity balancing: Adjust antibody concentrations to achieve comparable signal intensities between channels. RPS13 may require dilutions between 1:50-1:500, while other proteins might need different concentrations .

  • Sequential staining protocol: For challenging combinations, consider sequential staining protocols where one antigen is detected completely before beginning the second staining sequence.

  • Spectral overlap control: Choose fluorophores with minimal spectral overlap, and when necessary, perform sequential scanning or linear unmixing during confocal microscopy.

  • Appropriate controls:

    • Single-stained controls for each antibody

    • Secondary-only controls for each channel

    • Peptide competition controls to confirm specificity

  • Quantitative co-localization analysis: Use appropriate software (ImageJ with Coloc2, CellProfiler) and statistical methods (Pearson's correlation coefficient, Manders' overlap coefficient) for quantitative assessment rather than relying on visual impression alone.

These considerations ensure reliable and quantifiable co-localization data when studying RPS13 interactions with other cellular components.

How should antibody validation experiments be designed to ensure RPS13 specificity?

Designing comprehensive antibody validation experiments for RPS13 requires a multi-layered approach:

  • Expression modulation tests:

    • Knockdown validation: Perform siRNA or shRNA knockdown of RPS13 and verify signal reduction by Western blot (expect 70-90% reduction).

    • Overexpression validation: Transfect cells with RPS13 expression vector (with distinguishable tag) and confirm increased signal at appropriate molecular weight.

    • CRISPR/Cas9 knockout: Generate complete knockout cell lines as gold-standard negative controls where feasible.

  • Molecular validation:

    • Immunoprecipitation followed by mass spectrometry to confirm RPS13 as the primary precipitated protein.

    • Peptide competition assays using the immunizing peptide to block specific binding.

    • Testing against recombinant RPS13 protein of known concentration for sensitivity assessment .

  • Cross-platform validation:

    • Compare results across multiple techniques (WB, IHC, IF) using standardized samples.

    • Verify consistent subcellular localization patterns (primarily cytoplasmic for RPS13) .

  • Reproducibility assessment:

    • Test antibody performance across multiple lots.

    • Validate in different cell lines and tissue types.

    • Compare results to published literature and antibodies from different vendors.

  • Documentation standards:

    • Document all validation experiments with appropriate controls.

    • Record specific experimental conditions, including antibody dilutions, incubation times/temperatures, and buffer compositions.

    • Maintain validation data with antibody information in laboratory records.

This systematic validation approach ensures antibody specificity and reliability, which is essential for generating reproducible and trustworthy research data.

How can RPS13 antibodies be applied in single-cell analysis techniques?

RPS13 antibodies can be strategically integrated into single-cell analysis through several innovative approaches:

  • Single-cell immunofluorescence: Using RPS13 antibodies with optimized protocols (1:50-1:100 dilution) in combination with high-content imaging systems allows quantification of ribosome content heterogeneity across individual cells in complex populations .

  • Mass cytometry (CyTOF): Metal-conjugated RPS13 antibodies can be incorporated into CyTOF panels to simultaneously measure ribosomal content alongside dozens of other cellular markers, revealing correlations between ribosome abundance and cell state or identity.

  • Proximity ligation assays (PLA): Combining RPS13 antibodies with antibodies against potential interaction partners in PLA enables visualization and quantification of protein-protein interactions at the single-cell level, revealing functional heterogeneity.

  • Microfluidic-based single-cell Western blot: This emerging technique allows protein quantification in individual cells, with RPS13 serving as either a normalization marker or protein of interest.

  • Spatial transcriptomics integration: Correlating RPS13 protein localization (by immunofluorescence) with spatial transcriptomics data can reveal relationships between ribosome distribution and localized translation events in complex tissues.

  • Live-cell imaging with intrabodies: Developing RPS13-specific intrabodies enables tracking of ribosome dynamics in living cells without fixation artifacts.

These applications provide unprecedented insights into cellular heterogeneity in ribosome content and function, particularly relevant for understanding differentiation processes and disease progression at single-cell resolution.

What is the potential for using RPS13 antibodies in therapeutic applications?

While primarily research tools, RPS13 antibodies show several potential therapeutic applications that warrant investigation:

  • Targeted drug delivery systems: Antibody-drug conjugates targeting RPS13 could potentially deliver therapeutic payloads to cells with aberrant ribosome biogenesis, particularly relevant in cancer cells with elevated ribosomal protein expression .

  • Diagnostic imaging: Radiolabeled or fluorescently labeled RPS13 antibodies could aid in visualizing tumors with elevated RPS13 expression, particularly in gastric multidrug-resistant cancers where RPS13 overexpression has been documented .

  • Therapeutic resistance biomarkers: IHC staining for RPS13 in patient biopsies could help predict response to ribosome-targeting therapies, enabling personalized treatment approaches.

  • Immunotherapy targeting: In cancers where RPS13 is aberrantly expressed on cell surfaces or in extracellular vesicles, chimeric antigen receptor (CAR) T-cell approaches could potentially be developed.

  • Blocking antibodies for protein-protein interactions: If critical RPS13 interactions with non-ribosomal proteins are identified in disease states, blocking antibodies could disrupt these pathological interactions.

  • Small molecule discovery platform: RPS13 antibodies can facilitate high-throughput screening assays to identify small molecules that modulate ribosome biogenesis, potentially leading to novel therapeutic compounds.

While these applications remain largely theoretical and require substantial validation, they represent promising directions for translating basic RPS13 research toward clinical applications .

How might RPS13 antibodies contribute to understanding ribosomopathies and their treatments?

RPS13 antibodies can significantly advance our understanding of ribosomopathies through several strategic research approaches:

  • Comparative expression analysis: Using IHC and WB with RPS13 antibodies to compare expression patterns between healthy tissues and those affected by ribosomopathies can reveal tissue-specific alterations in ribosome composition .

  • Ribosome assembly monitoring: Antibody-based tracking of RPS13 incorporation into pre-ribosomal particles can identify assembly defects characteristic of specific ribosomopathies, potentially revealing intervention points.

  • Stress response characterization: Immunofluorescence analysis of RPS13 localization during cellular stress can elucidate how ribosomopathies alter normal stress response mechanisms.

  • Therapeutic effect assessment: Western blot analysis of RPS13 levels and modification states before and after experimental treatments can serve as markers of restoration of normal ribosome biogenesis.

  • Patient-derived organoid analysis: Using RPS13 antibodies in patient-derived organoid cultures can help characterize disease manifestations in relevant tissue contexts and screen potential therapeutics.

  • Extra-ribosomal function investigation: Immunoprecipitation with RPS13 antibodies followed by proteomics analysis can identify non-canonical interactions that may be disrupted in ribosomopathies.

  • Genetic rescue verification: In gene therapy approaches targeting ribosomopathies, RPS13 antibodies can confirm successful restoration of normal ribosomal protein incorporation and stoichiometry.

These applications contribute to both basic understanding of disease mechanisms and the development of targeted therapeutic approaches for this challenging class of genetic disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.