rsad1 Antibody
Description
Definition and Background
RSAD1 antibodies are polyclonal or monoclonal immunoglobulins designed to detect endogenous RSAD1 protein in tissues or cells. These antibodies are primarily raised in rabbits and target epitopes within the internal regions of the RSAD1 protein (e.g., amino acids 299–328) . The protein itself is a mitochondrial enzyme involved in porphyrin cofactor biosynthesis and radical-based reactions .
Structure and Immunogen
RSAD1 antibodies are typically affinity-purified from rabbit antiserum using peptide affinity chromatography . The immunogen is a synthesized peptide derived from human RSAD1 sequences, such as the internal region (e.g., VTLEANPTSA-PGSRLAEFGAAGVNRLSIGLQSLDDTELRL-LGRTHSACDA-LRTLAEARRLFPGRVSVDLM-LGLPAQQVGPWLGQLQELLHHC) .
| Immunogen Features | Details |
|---|---|
| Source | Synthetic peptide |
| Sequence region | Internal (e.g., 299–347 amino acids) |
| Host species | Rabbit |
| Purification method | Affinity chromatography |
Applications and Reactivity
RSAD1 antibodies are validated for multiple techniques:
-
Immunohistochemistry (IHC): Stains paraffin or frozen sections .
-
Immunofluorescence (IF): Localizes RSAD1 in subcellular compartments .
Species Reactivity:
Glioblastoma
RSAD1 is critical for glioblastoma stem cell (GSC) survival. Its knockdown impairs proliferation and induces chemosensitivity . RSAD1 expression correlates with worse prognosis, suggesting it as a therapeutic target .
Alzheimer’s Disease
RSAD1 mRNA and protein are elevated in neurons of Alzheimer’s patients, particularly in AT8+ (hyperphosphorylated tau) neurons. This links RSAD1 to neurodegeneration and metabolic dysregulation .
Porphyrin Biosynthesis
RSAD1’s mitochondrial localization and homology to oxygen-independent coproporphyrinogen III oxidases suggest a role in heme biosynthesis .
Product Specs
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
