MRPS8 Antibody

What is MRP8 and why is it an important research target?

MRP8, also known as S100A8 or calgranulin A, is an 11 kDa calcium-binding protein that forms heterodimeric complexes with MRP14 (S100A9). This protein complex (MRP8/14) serves as an important biomarker for inflammatory conditions and plays critical roles in inflammatory responses. MRP8 is primarily expressed in myeloid cells, including neutrophils and monocytes, making it a valuable marker for monitoring inflammation in various pathological conditions including transplant rejection . The protein contains 93 amino acids in humans, with the sequence beginning with MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIR and continuing through to KMGVAAHKKSHEESHKE .

What types of MRP8 antibodies are currently available for research?

Research laboratories can utilize several types of MRP8 antibodies:

• Polyclonal antibodies: Rabbit polyclonal antibodies like A16819 offer broad epitope recognition

• Monoclonal antibodies: Rat monoclonal antibodies such as M8I-74 provide higher specificity for particular epitopes

• Complex-specific antibodies: Some antibodies specifically recognize the MRP8/14 heterodimeric complex rather than individual subunits

Each type offers distinct advantages depending on the experimental requirements and application.

What are the validated applications for MRP8 antibodies?

MRP8 antibodies have been validated for multiple laboratory techniques:

• Western Blotting (WB): Typically used at dilutions of 1:100-1:500 to detect MRP8 protein in cell lysates

• Immunohistochemistry (IHC): Effective at dilutions of 1:50-1:200 for tissue sections

• Immunocytochemistry/Immunofluorescence (ICC/IF): Functions at dilutions of 1:50-1:100 for cellular localization studies

• ELISA: Specialized antibodies can be used in sandwich ELISA systems for quantitative measurement of MRP8/14 complex in serum with detection limits as low as 2 μg/L

What species reactivity is available for MRP8 antibodies?

Current MRP8 antibodies demonstrate cross-reactivity with samples from:

• Human: All referenced antibodies react with human MRP8

• Mouse: Some antibodies like A16819 cross-react with mouse MRP8

• Rat: Select antibodies can detect rat MRP8

This cross-reactivity is particularly valuable for translational research comparing inflammatory responses across species models.

What are the optimal conditions for Western blot detection of MRP8?

For successful Western blot detection of MRP8:

• Sample preparation: Use appropriate lysis buffers containing protease inhibitors

• Protein loading: 10-20 μg of total protein is typically sufficient

• Antibody dilution: Use primary antibody at 1:100-1:500 dilution

• Detection: Secondary antibodies conjugated to HRP work effectively with chemiluminescent detection systems

• Controls: THP-1 cells serve as a reliable positive control for MRP8 expression

The expected band should appear at approximately 11 kDa.

How should MRP8 antibodies be stored and handled to maintain activity?

To preserve antibody activity:

• Storage temperature: Store at -20°C after aliquoting to avoid freeze/thaw cycles

• Formulation: MRP8 antibodies are typically supplied in Phosphate Buffered Saline at pH 7.3 with 50% Glycerol and 0.01% Thiomersal

• Handling: Avoid repeated freeze-thaw cycles by preparing single-use aliquots

• Shipping: Antibodies are typically shipped at 4°C but should be stored at -20°C upon arrival

What are the appropriate controls for MRP8 antibody experiments?

For rigorous experimental design:

• Positive controls: THP-1 cells express MRP8 and serve as excellent positive controls for human studies

• Negative controls: Include isotype-matched control antibodies such as Rabbit IgG (A82272 or A17360)

• Secondary antibody controls: Omit primary antibody to detect non-specific binding of secondary antibodies

• Tissue controls: Include tissues known to express MRP8 (e.g., inflamed tissues) or lack MRP8 expression

How can MRP8/14 complex be accurately quantified in clinical samples?

The MRP8/14 complex can be measured using specialized ELISA systems:

• Detection limit: High-sensitivity ELISA systems can detect MRP8/14 concentrations as low as 2 μg/L

• Precision: Within-run CVs of 3.7-6.1% and between-day CVs of 5.6-8.7% for concentrations of 117-3300 μg/L ensure reliable measurements

• Recovery rate: Mean recovery of 104% (range 80-128%) demonstrates accuracy

• Sample types: Both serum and dried blood spots can be analyzed, though with varying sensitivity

How does MRP8/14 detection compare with other inflammatory markers?

MRP8/14 detection offers distinct advantages over traditional inflammatory markers:

• Temporal advantage: MRP8/14 elevations often precede C-reactive protein (CRP) increases by 1-7 days, allowing earlier detection of inflammatory responses

• Tissue specificity: Unlike CRP, MRP8/14 is sensitive to inflammatory reactions even when liver function is compromised

• Cellular origin: Direct release from activated neutrophils and monocytes provides a more direct measure of ongoing inflammation

• Correlation with histology: MRP8/14 elevation correlates with lymphocyte permeation into transplanted tissues during rejection events

What multiplexing strategies can incorporate MRP8 detection with other biomarkers?

Advanced multiplexing approaches include:

• Antibody arrays: Combining MRP8 antibodies with antibodies against other inflammatory markers

• Multiparameter flow cytometry: Using fluorescently-labeled MRP8 antibodies alongside other cellular markers

• Biosensor platforms: Technologies like GC-FP (Giant Colloid - Fluorescent Probe) allow simultaneous detection of multiple antibody responses with high sensitivity and specificity

• Machine learning integration: Combining data from multiple antigen-antibody reactions can improve diagnostic accuracy compared to single biomarker measurements

What experimental considerations are critical when studying MRP8 in different disease models?

When investigating MRP8 in disease contexts:

• Sample timing: MRP8/14 levels can change rapidly during inflammatory processes, necessitating strategic sampling timelines

• Sample handling: Standardized collection and processing protocols are essential as protein degradation can affect results

• Context-specific expression: MRP8 expression varies significantly between acute and chronic inflammatory conditions

• Complex formation: The ratio of MRP8 monomer to MRP8/14 complex may vary in different pathological states

How can MRP8 antibodies contribute to transplantation research?

MRP8 antibodies offer valuable tools for transplantation studies:

• Rejection monitoring: MRP8/14 increases occur simultaneously with lymphocyte permeation into transplanted tissues during rejection

• Early detection: MRP8/14 elevations precede conventional markers like CRP, allowing earlier intervention

• Liver transplant advantage: MRP8/14 detection remains reliable even when liver function is compromised, unlike CRP

• Small intestine transplant applications: MRP8/14 has demonstrated utility for monitoring rejection in small intestine transplantation

What are common issues when using MRP8 antibodies and how can they be resolved?

Researchers frequently encounter these challenges:

• High background: Increase blocking time/concentration and optimize antibody dilutions

• Multiple bands: Ensure sample freshness and proper protein extraction; consider using monoclonal antibodies for higher specificity

• Weak signal: Increase antibody concentration, extend incubation time, or enhance detection methods

• Cross-reactivity: Validate antibody specificity using appropriate controls and consider pre-absorption with related proteins

How should contradictory results with different MRP8 antibodies be interpreted?

When facing inconsistent results:

• Epitope differences: Different antibodies target distinct epitopes that may be differentially accessible in various experimental conditions

• Clone specificity: Monoclonal antibodies may recognize specific conformations or post-translational modifications

• Validation approach: Cross-validate findings using multiple detection methods (e.g., ELISA, Western blot, and immunohistochemistry)

• Technical variables: Standardize experimental conditions including fixation methods, antigen retrieval, and detection systems

What quantitative methods provide the most reliable measurements of MRP8 levels?

For accurate quantification:

• ELISA: Provides precise concentration measurements with detection limits as low as 2 μg/L

• Western blot densitometry: Useful for relative quantification with appropriate housekeeping controls

• Biosensor platforms: Novel technologies like GC-FP offer quantitative detection with high correlation to established methods (Pearson r > 0.9)

• Digital PCR methods: Can be used for highly sensitive detection of genetic expression

How can machine learning enhance MRP8 antibody-based diagnostics?

Machine learning approaches offer significant advantages:

• Improved classification: ML models trained on combined antibody responses can yield superior diagnostic accuracy (100% selectivity, 80% sensitivity in some applications)

• Pattern recognition: ML can identify subtle patterns across multiple biomarkers that may not be apparent through conventional analysis

• Threshold optimization: Receiver operator characteristic (ROC) analysis can determine optimal detection thresholds for diagnostic applications

• Quantitative prediction: ML models can correlate antibody binding measurements with clinical outcomes

How might novel antibody technologies advance MRP8 research?

Emerging technologies promise new capabilities:

• Bispecific antibodies: Similar to those developed for HIV research, bispecific antibodies could target MRP8 alongside other inflammatory mediators for enhanced detection or therapeutic applications

• Long-acting antibody formulations: Extended half-life modifications could enable longitudinal monitoring with reduced sampling frequency

• Intramuscular delivery systems: Development of injection formulations could simplify antibody administration in clinical settings

• Microfluidic platforms: Integration with point-of-care devices could enable rapid inflammation monitoring in resource-limited settings

What are unexplored applications of MRP8 antibodies in clinical research?

Potential new research directions include:

• Battlefield medicine: MRP8/14 detection could serve as an early indicator of inflammatory complications in trauma cases

• Predictive biomarkers: Early MRP8/14 increases might predict treatment response or disease progression

• Therapeutic monitoring: Quantifying MRP8/14 could provide objective measures of anti-inflammatory treatment efficacy

• Personalized medicine: Individual MRP8/14 profiles might guide tailored therapeutic approaches for inflammatory conditions