rundc3b Antibody

What is RUNDC3B and what are its key structural features?

RUNDC3B (RUN Domain Containing 3B) is a protein containing a characteristic RUN domain in its N-terminal region that mediates interaction with Rap2, which is an important component of the mitogen-activated protein kinase (MAPK) cascade . The protein sequence contains binding sites for MAPK intermediates, suggesting its role as a mediator between Rap2 and the MAPK signaling cascade . RUNDC3B is also known by several other names including Rap2-binding protein 9, Rap2-interacting protein 9, RPIB9, RPIP-9, and RPIP9 .

The antibody against RUNDC3B was developed using a recombinant protein corresponding to the amino acid sequence: TPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTLEQKGYLEE . This region serves as the immunogen for generating specific antibodies that can recognize RUNDC3B in various experimental applications.

What are the validated applications for RUNDC3B antibodies?

RUNDC3B antibodies have been validated for several research applications:

The antibody specificity has been verified on protein arrays containing the target protein plus 383 other non-specific proteins, ensuring high selectivity for RUNDC3B detection . This validation process is critical for researchers to have confidence in their experimental results when using these antibodies.

In which tissues is RUNDC3B expressed?

RUNDC3B is expressed in multiple tissues throughout the body. Based on available research data, RUNDC3B expression has been detected in:

• Brain

• Thymus

• Ovary

• Testis

• Leukocytes

• Liver

• Small intestines

• Prostate

This wide distribution suggests that RUNDC3B may have varied functions depending on the cellular context. Researchers should consider this tissue distribution when designing experiments targeting RUNDC3B in specific cellular systems.

How should RUNDC3B antibodies be stored and handled?

For optimal antibody performance and longevity, RUNDC3B antibodies should be stored according to these guidelines:

• Short-term storage: 4°C

• Long-term storage: Aliquot and store at -20°C

• Avoid freeze-thaw cycles to maintain antibody integrity

The antibody is typically supplied in PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide as a preservative . When planning experiments, researchers should consider these storage conditions to ensure maximum antibody efficacy and reproducible results.

What is the relationship between RUNDC3B methylation and gene expression?

RUNDC3B expression is significantly influenced by the methylation status of its promoter region. Research has demonstrated a strong inverse correlation between methylation density and gene expression (Spearman's rank correlation ρ = 0.77, p < 0.001) .

Studies on cancer cell lines revealed that lymphoid malignancies displayed more prominent methylation of the RUNDC3B promoter and correspondingly did not express RUNDC3B, compared to myeloid malignancies and solid tumors . This epigenetic silencing mechanism appears to be specific to lymphoid cancers, suggesting its potential use as a biomarker.

Statistical analysis using odds ratios showed significant inverse associations between CpG island methylation and RUNDC3B expression in multiple regions of interest:

Notably, regions 2, 3, 4, and 6 were consistently methylated in lymphoid cell lines that did not express RUNDC3B and unmethylated in those that did express it . This pattern suggests that these specific regions are critical for regulating RUNDC3B expression.

What role does RUNDC3B play in the ABCB1-amplicon and cancer drug resistance?

RUNDC3B is part of the ABCB1-amplicon, a gene locus at 7q21.12 that has been implicated in multidrug resistance in cancer cells . In prostate cancer models resistant to taxane chemotherapies (docetaxel and cabazitaxel), RUNDC3B was found to be significantly overexpressed alongside other genes in this amplicon .

Functional studies using siRNA-mediated inhibition of RUNDC3B demonstrated:

• Reduced cellular viability in both sensitive and resistant prostate cancer cell lines

• More pronounced reduction in viability observed in taxane-resistant derivatives

• Limited direct effect on docetaxel resistance

• Sensitization to high doses of cabazitaxel in resistant cell lines

These findings suggest that RUNDC3B primarily contributes to cellular survival mechanisms in taxane-resistant cells rather than directly influencing drug sensitivity. Additionally, clinical data analysis showed that high RUNDC3B expression correlates with decreased patient disease-free survival in prostate adenocarcinoma , highlighting its potential prognostic value.

How can researchers effectively measure RUNDC3B expression?

Quantitative measurement of RUNDC3B expression is crucial for understanding its role in normal and pathological processes. Based on published methodologies, researchers can employ:

Quantitative Real-Time PCR (qRT-PCR):

• Use Taqman primer/probe sets (e.g., Applied Biosystems RUNDC3B Hs00379227_m1)

• Include appropriate housekeeping genes (e.g., GAPDH Hs0392909_g1) for normalization

• Standard reaction conditions: 50°C for 2 min, 60°C for 30 min (reverse transcription), 95°C for 5 min, followed by 40 cycles of 94°C for 20 s and 62°C for 1 min

• Consider Cycle threshold (CT) values below 35 as positive expression

Data Analysis Approach:

• Calculate ΔCt values by subtracting the CT of housekeeping genes from the CT of RUNDC3B

• Consider CT values >35 as non-expressing

• Perform statistical analyses to correlate expression with other parameters (e.g., methylation status, clinical outcomes)

What experimental approaches can determine RUNDC3B promoter methylation status?

For researchers investigating the epigenetic regulation of RUNDC3B, these methodological approaches have proven effective:

• Bisulfite Conversion and Methylation-Specific PCR:

  • Treat DNA with bisulfite to convert unmethylated cytosines to uracils

  • Design primers specific to methylated and unmethylated sequences

  • Score regions as unmethylated, partially methylated, or methylated based on PCR results

• Methylation Density Scoring System:

  • Assign numerical values: 1 (methylated), 0.5 (partially methylated), 0 (unmethylated)

  • Calculate methylation density by averaging values across all regions

  • Correlate with expression data using Spearman's rank correlation

• Demethylating Agent Treatment:

  • Treat cells with agents such as 5-aza-2'-deoxycytidine

  • Monitor restoration of RUNDC3B expression by qRT-PCR

  • Confirm the causal relationship between methylation and gene silencing

This comprehensive approach allows researchers to establish the relationship between RUNDC3B methylation and expression, particularly in cancer models.

How does RUNDC3B interact with cellular signaling pathways?

RUNDC3B contains binding sites for MAPK intermediates and interacts with Rap2, suggesting its involvement in the MAPK signaling cascade . Current evidence points to several potential mechanisms:

• MAPK Pathway Mediation:

  • RUNDC3B likely serves as a mediator between Rap2 and the MAPK signaling cascade

  • Its loss through hypermethylation may lead to dysregulated MAPK signaling

• Downstream Gene Regulation:

  • Studies have shown that three genes with MAPK-inducible expression (HSPA5, Jun, and Fos) were downregulated in a methylated leukemia cell line lacking RUNDC3B expression

  • Jun and Fos combine to form the activating protein 1 transcription factor, important for regulating differentiation and proliferation

• RAS-like GTPase Signaling:

  • Based on its structure, RUNDC3B may function in the RAS-like GTPase signaling pathway

  • This connection further links RUNDC3B to cellular processes involved in cancer progression

Research suggests that loss of RUNDC3B through aberrant hypermethylation of the early growth response 3 transcription factor binding site may result in dysregulated MAPK signaling, potentially contributing to carcinogenesis in lymphoid malignancies .

How can researchers validate RUNDC3B antibody specificity?

Ensuring antibody specificity is crucial for generating reliable research data. For RUNDC3B antibodies, researchers should consider these validation approaches:

• Protein Array Verification:

  • Commercial RUNDC3B antibodies are typically verified on protein arrays containing the target protein plus numerous non-specific proteins

  • Researchers can perform similar validation using arrays or western blots with positive and negative controls

• Peptide Competition Assays:

  • Pre-incubate the antibody with excess immunizing peptide

  • Compare staining patterns with and without peptide competition

  • Specific signals should be blocked by the peptide

• Multiple Antibody Approach:

  • Use different antibodies targeting distinct epitopes of RUNDC3B

  • Consistent results across different antibodies increase confidence in specificity

• Genetic Manipulation Controls:

  • Include RUNDC3B knockdown or knockout samples

  • Signal should be reduced or absent in these negative controls

What are the optimal protocols for using RUNDC3B antibodies in immunohistochemistry?

For researchers using RUNDC3B antibodies in immunohistochemistry applications, the following protocol considerations are recommended:

Immunohistochemistry-Paraffin (IHC-P) Protocol:

• Sample Preparation:

  • Fix tissues in 10% neutral buffered formalin

  • Process and embed in paraffin using standard methods

  • Section tissues at 4-6 μm thickness

• Antigen Retrieval:

  • Deparaffinize and rehydrate sections

  • Perform heat-induced epitope retrieval (HIER) using citrate buffer (pH 6.0) or EDTA buffer (pH 9.0)

  • Heat in a pressure cooker or microwave for optimal antigen retrieval

• Antibody Incubation:

  • Block endogenous peroxidase with 3% H₂O₂

  • Apply protein block to reduce non-specific binding

  • Dilute RUNDC3B antibody in recommended buffer at 1:200-1:500

  • Incubate at 4°C overnight or at room temperature for 1-2 hours

• Detection and Visualization:

  • Apply appropriate secondary antibody

  • Develop with DAB or other chromogens

  • Counterstain with hematoxylin

  • Mount with permanent mounting medium

• Controls:

  • Include positive controls (tissues known to express RUNDC3B)

  • Include negative controls (omit primary antibody)

  • Consider using tissues with known methylation status of RUNDC3B

What experimental designs are recommended for studying RUNDC3B in cancer drug resistance?

Based on published research, these experimental approaches are effective for investigating RUNDC3B's role in drug resistance:

• Development of Resistant Cell Models:

  • Expose cancer cells to increasing concentrations of taxanes (docetaxel, cabazitaxel)

  • Characterize resistant derivatives through viability assays

  • Confirm RUNDC3B expression changes by qRT-PCR and western blotting

• Gene Knockdown Studies:

  • Use siRNA or shRNA to downregulate RUNDC3B expression

  • Assess the impact on cell viability in both sensitive and resistant cell lines

  • Evaluate changes in drug sensitivity using dose-response curves

• Combination Studies:

  • Combine RUNDC3B inhibition with taxane treatment

  • Test different dosing schedules (concurrent vs. sequential)

  • Evaluate synergistic effects using combination index calculations

• Clinical Correlation:

  • Analyze RUNDC3B expression in patient samples using IHC or gene expression data

  • Correlate with treatment response and survival outcomes

  • Use cBioPortal data to examine ABCB1-amplicon gene co-amplification patterns

How can RUNDC3B methylation be utilized as a biomarker in clinical research?

RUNDC3B methylation shows promise as a biomarker, particularly in lymphoid malignancies. Research indicates that:

• Differential Methylation Patterns:

  • Lymphoid malignancies show more prominent methylation compared to myeloid malignancies and solid tumors

  • This specificity supports the potential use of RUNDC3B methylation as a biomarker for lymphoid cancers

• Diagnostic Applications:

  • Researchers can develop methylation-specific PCR assays targeting the most informative regions (2, 3, 4, and 6)

  • These assays could potentially distinguish lymphoid from myeloid leukemias

• Methodological Approach:

  • Collect patient samples (bone marrow, peripheral blood, or tissue biopsies)

  • Extract DNA and perform bisulfite conversion

  • Perform methylation-specific PCR targeting RUNDC3B promoter regions

  • Analyze results using the methylation density scoring system

• Clinical Correlation:

  • Correlate methylation status with disease characteristics

  • Monitor changes in methylation patterns during treatment

  • Evaluate potential for predicting treatment response or disease progression

What is the evidence linking RUNDC3B to patient outcomes in different cancer types?

Emerging evidence suggests that RUNDC3B expression may have prognostic significance:

• Prostate Cancer:

  • High RUNDC3B expression correlates with decreased disease-free survival in prostate adenocarcinoma patients

  • Part of the ABCB1-amplicon that shows coordinated amplification in prostate tumors

• Breast Cancer:

  • RUNDC3B overexpression has been associated with poor prognosis

  • May contribute to treatment resistance mechanisms

• Ovarian Cancer:

  • Linked to taxane resistance

  • Potential therapeutic target for overcoming treatment insensitivity

• Lymphoid Malignancies:

  • Methylation-associated silencing may play a role in pathogenesis

  • Potential diagnostic biomarker to distinguish lymphoid from myeloid malignancies

These findings collectively suggest that RUNDC3B may serve as both a prognostic marker and a therapeutic target in various cancer types, with specific mechanisms differing by cancer type.

What are the key unanswered questions about RUNDC3B function?

Despite recent advances, several critical questions about RUNDC3B remain unanswered:

• Molecular Mechanisms:

  • How does RUNDC3B specifically interact with the MAPK pathway components?

  • What are the direct binding partners of RUNDC3B besides Rap2?

  • How is RUNDC3B activity regulated post-translationally?

• Cancer Biology:

  • What mechanisms drive the coordinated amplification of the ABCB1-amplicon genes?

  • How does RUNDC3B contribute to cellular survival independent of direct drug resistance?

  • Are there cancer-specific isoforms or mutations of RUNDC3B with functional consequences?

• Therapeutic Potential:

  • Can RUNDC3B be directly targeted therapeutically?

  • Would combined inhibition of multiple ABCB1-amplicon genes overcome resistance more effectively than targeting ABCB1 alone?

  • Could demethylating agents restore RUNDC3B expression and sensitivity in lymphoid malignancies?

Addressing these questions will require innovative experimental approaches and could lead to significant advances in understanding cancer biology and developing novel therapeutic strategies.