SAA2 Antibody, FITC conjugated

Target and Structure

• Target Protein: SAA2 (Serum Amyloid A2), a 122-amino-acid protein (13 kDa) and apolipoprotein component of HDL .

• Epitope: C-terminal region (peptide sequence: GAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGL) .

• Conjugation: FITC, a green fluorescent dye linked to primary amines (e.g., lysine residues), enabling detection at 488 nm excitation .

Primary Techniques

1. Immunofluorescence (IF)/Flow Cytometry (FCM):

   • Detects SAA2 expression in cells or tissues using fluorescence microscopy or FCM .

   • Example: Studying SAA2 localization in inflammatory responses or lipid-rich environments.

2. Western Blot (WB):

   • Identifies SAA2 in lysates, though FITC-conjugated antibodies are less common in WB compared to enzyme-linked secondary antibodies .

3. Immunohistochemistry (IHC):

   • Visualizes SAA2 in fixed tissue sections, particularly in studies of amyloidosis or chronic inflammation .

Key Research Insights

• Innate Immunity: SAA2 interacts with formyl peptide receptor 2 (FPR2), mediating type 2 inflammation in allergic responses .

• Lipid Metabolism: SAA2 binds to HDL, influencing cholesterol transport and atherogenesis .

Research Challenges and Solutions

• Background Noise: High conjugation ratios (>6 FITC/antibody) may reduce specificity. Optimal ratios (3–6) are recommended .

• Cross-Reactivity: Validate specificity using blocking peptides (e.g., Catalog # AAP63629 for AvivaSysBio) .