SCAF1 Antibody

What is SCAF1 and why is it important in molecular biology research?

SCAF1 (SR-related CTD-associated factor 1) is a nuclear protein involved in RNA metabolism, particularly pre-mRNA splicing and transcriptional regulation. Its importance stems from its role in gene expression pathways and potential implications in diseases such as cancer and neurological disorders. As a member of the Splicing factor SR protein family, SCAF1 contributes to the precise control of RNA processing, making it a significant target for researchers investigating fundamental cellular mechanisms . Studies involving SCAF1 can provide insights into splicing regulation and gene expression control systems that are essential for normal cellular function.

What are the main characteristics of commercially available SCAF1 antibodies?

Most commercially available SCAF1 antibodies are polyclonal antibodies produced in rabbits with reactivity primarily against human and mouse SCAF1. These antibodies typically target epitopes in the N-terminal region of human SCAF1 and are formulated in PBS containing 50% glycerol, 0.5% BSA, and small amounts of sodium azide as a preservative. They are validated for Western blot applications with recommended dilutions of 1:500-1:2000 and ELISA applications with dilutions up to 1:40000 . The antibodies recognize SCAF1, which has a calculated molecular weight of approximately 139.3 kDa . Most are affinity-purified from rabbit antiserum using epitope-specific immunogens to ensure specificity .

What is the significance of SCAF1's tissue distribution pattern for designing experiments?

SCAF1 exhibits a ubiquitous expression pattern but with notable tissue-specific variations that should inform experimental design. It is highly expressed in fetal brain and liver tissues, while showing reduced expression in salivary gland, heart, skin, and ovary . Additionally, SCAF1 is expressed in colorectal carcinomas and ovarian cancers, with overexpression observed in colorectal carcinomas compared to normal colonic mucosa . These expression patterns suggest that researchers should select appropriate positive control tissues when validating antibody performance. For developmental studies, fetal brain and liver samples would be optimal positive controls, while studies on cancer mechanisms might benefit from comparing colorectal cancer tissues with normal mucosa to observe differential expression. Understanding these tissue-specific patterns enables more precise experimental design and more meaningful interpretation of results.

What are the optimal conditions for using SCAF1 antibodies in Western blot applications?

For optimal Western blot results with SCAF1 antibodies, researchers should use the following protocol:

• Sample preparation: Extract nuclear proteins preferentially since SCAF1 is primarily localized in the nucleus .

• Protein loading: Load 20-30 μg of total protein per lane.

• Gel percentage: Use 6-8% SDS-PAGE gels due to SCAF1's high molecular weight (139.3 kDa) .

• Transfer conditions: Perform longer transfer times (overnight at 30V) with standard PVDF membranes.

• Blocking: Block with 5% non-fat dry milk in TBST for 1 hour at room temperature.

• Primary antibody incubation: Dilute SCAF1 antibody at 1:500-1:2000 in blocking buffer and incubate overnight at 4°C .

• Washing: Wash 3-4 times with TBST, 5-10 minutes each.

• Secondary antibody: Use anti-rabbit HRP conjugate at 1:5000-1:10000 dilution for 1 hour at room temperature.

• Detection: Use enhanced chemiluminescence with appropriate exposure times to detect the 139.3 kDa band.

This methodology ensures specific detection of SCAF1 protein with minimal background interference, especially important when working with complex tissue samples.

How can researchers validate the specificity of SCAF1 antibodies in their experimental systems?

Validating SCAF1 antibody specificity requires a multi-pronged approach:

• Positive and negative controls:

  • Use tissues known to express SCAF1 highly (fetal brain, liver) as positive controls

  • Include tissues with low expression (salivary gland, heart) as comparative controls

  • Include a negative control without primary antibody

• Knockdown validation:

  • Perform siRNA or CRISPR-based knockdown of SCAF1

  • Compare Western blot signal between control and knockdown samples

  • Expect significant reduction in band intensity at 139.3 kDa in knockdown samples

• Peptide competition assay:

  • Pre-incubate antibody with excess immunizing peptide

  • Expect blocking of specific signal in Western blot or immunostaining

• Molecular weight verification:

  • Confirm detected band matches the predicted 139.3 kDa size

  • Check for potential isoforms or post-translational modifications

• Orthogonal techniques:

  • Validate expression using qPCR or mass spectrometry

  • Results should correlate with antibody-based detection methods

These validation steps ensure that experimental findings are based on specific detection of SCAF1 rather than cross-reactivity or non-specific binding.

What considerations are important when comparing different SCAF1 antibodies for immunohistochemistry applications?

When selecting and comparing SCAF1 antibodies for immunohistochemistry (IHC), researchers should consider:

• Epitope targeting:

  • Antibodies targeting different epitopes may show different staining patterns

  • N-terminal targeted antibodies (like those derived from the sequence SRKVKLQSKVAVLIREGVSSTTPAKDAASAGLGSIGVKFSRDRESRSPFLKPDERAPTEMAKAAPGSTKPKKTKVKAKAGAKKTKGTKGKTKPSKT) may perform differently than those targeting other regions

• Fixation compatibility:

  • Test antibody performance in both formalin-fixed paraffin-embedded (FFPE) and frozen sections

  • Optimal dilution ranges differ by preparation method (typically 1:50-1:200 for FFPE)

• Antigen retrieval requirements:

  • Determine whether heat-induced epitope retrieval enhances staining

  • Test different pH conditions (citrate buffer pH 6.0 vs. EDTA buffer pH 9.0)

• Detection systems:

  • Compare DAB chromogenic vs. fluorescent detection methods

  • Evaluate signal amplification systems for low-expression tissues

• Background evaluation:

  • Assess non-specific staining in tissues known to be negative for SCAF1

  • Evaluate need for additional blocking steps

• Nuclear staining pattern:

  • Confirm nuclear localization pattern consistent with SCAF1's known cellular location

  • Evaluate staining pattern in tissues with known differential expression

These considerations help researchers select the most appropriate antibody for their specific IHC applications and tissue types.

How can SCAF1 antibodies be used to investigate pre-mRNA splicing mechanisms?

SCAF1 antibodies provide powerful tools for investigating pre-mRNA splicing through several advanced applications:

• Chromatin Immunoprecipitation (ChIP):

  • Use SCAF1 antibodies to immunoprecipitate chromatin complexes

  • Identify genomic regions where SCAF1 binds during transcription

  • Combine with RNA Pol II ChIP to determine co-occupancy at splice junctions

• RNA Immunoprecipitation (RIP):

  • Immunoprecipitate SCAF1-RNA complexes to identify target transcripts

  • Sequence associated RNAs to define binding motifs and preferences

  • Compare results with known splicing enhancer/silencer sequences

• Co-immunoprecipitation studies:

  • Identify protein complexes containing SCAF1 and other splicing factors

  • Map interactions within the spliceosome assembly

  • Evaluate how these interactions change under different cellular conditions

• Immunofluorescence co-localization:

  • Visualize SCAF1 localization with other splicing factors

  • Track dynamic changes during cell cycle or stress responses

  • Quantify nuclear speckle association in different cell types

• Proximity ligation assays:

  • Detect and quantify in situ interactions between SCAF1 and components of the splicing machinery

  • Map spatial organization of splicing complexes within the nucleus

These approaches collectively provide insights into SCAF1's role in pre-mRNA processing mechanisms and its broader function in gene expression regulation .

What is the relationship between SCAF1, SCAF4, and SCAF8 in RNA processing, and how can antibodies help distinguish their functions?

SCAF1, SCAF4, and SCAF8 share structural similarities but have distinct evolutionary and functional relationships that can be investigated using specific antibodies:

• Evolutionary relationships:

  • SCAF4 and SCAF8 likely arose from gene duplication in vertebrates

  • SCAF1 belongs to the same protein family but has distinct evolutionary origins

  • All contain CTD-interaction domains (CID) characteristic of termination factors

• Functional differences:

  • SCAF4 and SCAF8 function redundantly as mRNA anti-terminators, suppressing the use of early alternative polyadenylation sites

  • SCAF1 is primarily involved in pre-mRNA splicing regulation

  • These distinct functions reflect divergent evolution of these related proteins

• Using antibodies to distinguish functions:

  • Perform simultaneous knockdown experiments for SCAF1/4/8 with antibody validation

  • Conduct ChIP-seq with specific antibodies to map binding profiles genome-wide

  • Compare RNA processing changes (splicing vs. termination) using RNA-seq after individual knockdowns

  • Immunoprecipitate each factor and analyze associated proteins and RNAs

• Combinatorial analyses:

  • Investigate potential compensatory mechanisms between family members

  • Study potential functional overlap in various cell types and conditions

  • Compare binding affinities to RNA polymerase II CTD phospho-isoforms

This comparative approach using specific antibodies enables researchers to disentangle the unique and overlapping functions of these related SR proteins in RNA processing pathways .

How can SCAF1 antibodies be used to investigate its potential role in cancer progression?

SCAF1 antibodies provide valuable tools for investigating its role in cancer progression through several methodological approaches:

• Expression profiling across cancer types:

  • Use immunohistochemistry with SCAF1 antibodies on tissue microarrays

  • Quantify expression differences between normal and cancerous tissues

  • Compare expression levels with clinical outcomes and staging

  • Focus particularly on colorectal carcinomas where SCAF1 overexpression has been documented

• Mechanistic studies in cancer models:

  • Investigate changes in splicing patterns in SCAF1-overexpressing cells

  • Identify cancer-specific alternatively spliced isoforms regulated by SCAF1

  • Use ChIP-seq to map altered binding profiles in cancer cells

• Therapeutic target evaluation:

  • Screen for compounds that disrupt SCAF1 function or expression

  • Use antibodies to monitor on-target effects of potential therapeutics

  • Investigate consequences of SCAF1 depletion on cancer cell survival

• Biomarker development:

  • Assess correlation between SCAF1 expression and response to therapy

  • Develop immunohistochemistry-based diagnostic assays

  • Create an expression scoring system for patient stratification

• Signaling pathway integration:

  • Investigate how SCAF1 interacts with cancer-associated signaling pathways

  • Determine if SCAF1 expression is regulated by oncogenic transcription factors

  • Study post-translational modifications of SCAF1 in cancer contexts

These approaches leverage SCAF1 antibodies to uncover the molecular mechanisms by which SCAF1 may contribute to cancer development and progression, particularly in colorectal and ovarian cancers where its altered expression has been documented .

How should researchers troubleshoot multiple bands or unexpected molecular weights when using SCAF1 antibodies in Western blot?

When encountering multiple bands or unexpected molecular weights with SCAF1 antibodies, consider this systematic troubleshooting approach:

• Expected pattern: SCAF1 should appear at approximately 139.3 kDa . Common issues and solutions include:

• Multiple bands:

  • Potential isoforms: Check protein databases for documented SCAF1 splice variants

  • Degradation: Add fresh protease inhibitors during extraction, reduce sample handling time

  • Post-translational modifications: Test dephosphorylation treatments to consolidate bands

  • Cross-reactivity: Perform peptide competition assay to identify specific vs. non-specific bands

• Unexpected molecular weight:

  • Higher than expected: Check for post-translational modifications (phosphorylation, ubiquitination)

  • Lower than expected: Examine for proteolytic cleavage or alternative start sites

  • Consider sample preparation artifacts: Change lysis buffer composition

  • Test different reducing conditions if disulfide bonds may affect migration

• Validation strategies:

  • Compare multiple antibodies targeting different SCAF1 epitopes

  • Use positive control lysates from tissues with known high SCAF1 expression (fetal brain, liver)

  • Perform RNA interference to confirm which bands decrease with SCAF1 knockdown

  • Consider mass spectrometry to identify unexpected bands

• Technical optimizations:

  • Adjust gel percentage (6-8% recommended for high molecular weight proteins)

  • Optimize transfer conditions (time, buffer composition, voltage)

  • Test different blocking agents to reduce non-specific binding

This systematic approach helps distinguish between technical artifacts and biologically relevant findings when interpreting SCAF1 Western blot results.

What considerations are important when analyzing SCAF1 subcellular localization data from immunofluorescence experiments?

When analyzing SCAF1 subcellular localization using immunofluorescence, researchers should consider these critical factors:

• Expected pattern: SCAF1 should predominantly show nuclear localization . When interpreting results:

• Nuclear distribution assessment:

  • Distinguish between diffuse nuclear staining and nuclear speckle patterns

  • Quantify co-localization with nuclear speckle markers (SC35, SRSF2)

  • Evaluate nucleolar exclusion/inclusion patterns

  • Compare distribution across different cell cycle phases

• Quality control considerations:

  • Include appropriate controls:

    • Positive control: Cells known to express SCAF1 (most cell types, especially from tissues with high expression)

    • Negative control: Primary antibody omission

    • Knockdown control: siRNA-treated cells

  • Z-stack imaging: Collect multi-plane images to ensure complete nuclear pattern visualization

  • Resolution limitations: Consider super-resolution techniques for detailed nuclear speckle analysis

• Stimulus-dependent relocalization:

  • Monitor changes after transcriptional inhibition (DRB, α-amanitin)

  • Assess responses to splicing inhibitors (isoginkgetin, pladienolide B)

  • Document stress-induced reorganization (heat shock, oxidative stress)

  • Track changes during differentiation or cell cycle progression

• Quantification approaches:

  • Intensity measurements: Nuclear vs. cytoplasmic ratio

  • Pattern analysis: Speckle size, number, and intensity

  • Colocalization metrics: Pearson's correlation coefficient with other RNA processing factors

  • Single-cell variability assessment within populations

These analytical considerations ensure robust interpretation of SCAF1 localization data and provide insights into its functional dynamics within the nucleus.

How can researchers distinguish between specific and non-specific signals when using SCAF1 antibodies in complex tissues?

Distinguishing specific from non-specific signals when using SCAF1 antibodies in complex tissues requires a comprehensive validation approach:

• Control panel implementation:

  • Technical controls:

    • No primary antibody control to assess secondary antibody non-specific binding

    • Isotype control antibody at matching concentration

    • Blocking peptide competition to neutralize specific binding

  • Biological controls:

    • Tissues with known high expression (fetal brain, liver) vs. low expression (salivary gland, heart)

    • SCAF1 knockout or knockdown tissue sections when available

    • Comparative staining with multiple SCAF1 antibodies targeting different epitopes

• Signal pattern evaluation:

  • Specific SCAF1 signal should be:

    • Predominantly nuclear

    • Consistent with known expression patterns across tissues

    • Reproducible across technical replicates

  • Non-specific signals often show:

    • Inconsistent subcellular localization

    • Edge artifacts or uniform staining across diverse structures

    • Persistence in blocking peptide competition assays

• Advanced validation techniques:

  • Dual immunofluorescence with antibodies targeting different SCAF1 regions

  • Correlation with mRNA expression (RNAscope or in situ hybridization)

  • Orthogonal validation through proteomics or RNA-seq from the same tissues

  • Titration series to identify optimal antibody concentration that maximizes signal-to-noise ratio

• Tissue-specific considerations:

  • Optimize antigen retrieval for each tissue type

  • Account for tissue autofluorescence (particularly in brain, liver tissues)

  • Consider fixation artifacts that may affect epitope accessibility

  • Evaluate potential cross-reactivity with tissue-specific proteins

This systematic approach helps researchers confidently distinguish genuine SCAF1 signals from technical artifacts when working with complex tissue samples.

What experimental design is recommended for studying SCAF1's role in RNA splicing regulation?

A comprehensive experimental design for investigating SCAF1's role in RNA splicing should incorporate these methodological approaches:

• Functional genomics approach:

  • CRISPR-Cas9 knockout or knockdown of SCAF1

  • RNA-seq analysis to identify altered splicing events (exon skipping, intron retention, alternative 5'/3' splice sites)

  • rMATS or similar computational pipeline for splicing event quantification

  • Validation of key events with RT-PCR and isoform-specific primers

• Mechanistic studies:

  • CLIP-seq (Cross-linking immunoprecipitation sequencing) using SCAF1 antibodies to identify direct RNA binding sites

  • Motif analysis to determine SCAF1 binding preferences

  • Minigene splicing assays for candidate regulated exons

  • In vitro splicing assays with recombinant SCAF1 and mutant constructs

• Protein interaction network:

  • Immunoprecipitation with SCAF1 antibodies followed by mass spectrometry

  • Proximity labeling approaches (BioID, APEX) to identify neighboring proteins

  • Yeast two-hybrid screening for direct interaction partners

  • Validation of key interactions with co-immunoprecipitation and FRET techniques

• Dynamics and regulation:

  • Phosphorylation-specific antibodies to track SCAF1 post-translational modifications

  • Live-cell imaging with fluorescently tagged SCAF1 to monitor dynamics

  • Stimulus-response experiments with splicing modulators

  • Cell cycle synchronization to assess phase-specific functions

This multi-faceted approach provides comprehensive insights into SCAF1's functional role in RNA splicing regulation by combining genomic, biochemical, and cell biological techniques.

What comparative analysis could reveal functional relationships between SCAF1 and other SR proteins?

A systematic comparative analysis to uncover functional relationships between SCAF1 and other SR proteins should include:

• Genomic binding profile comparison:

  • Perform ChIP-seq with antibodies against SCAF1 and other SR proteins

  • Compare binding patterns at exon-intron boundaries, promoters, and enhancers

  • Identify unique and overlapping target genes

  • Analyze binding motif preferences through computational approaches

• Splicing outcome analysis:

  • Conduct parallel RNA-seq experiments after individual knockdowns

  • Create a comparative database of affected splicing events

  • Perform hierarchical clustering of splicing patterns to group functionally related SR proteins

  • Validate with minigene assays for representative splicing events

• Protein-protein interaction landscape:

  • Systematic immunoprecipitation with antibodies against each SR protein

  • Generate comprehensive interaction network maps

  • Identify unique vs. shared interacting partners

  • Determine if SCAF1 participates in specific subcomplexes

• Evolutionary analysis:

  • Compare SCAF1 with SCAF4/SCAF8 which evolved from gene duplication in vertebrates

  • Assess functional divergence through complementation assays

  • Analyze domain conservation across species

  • Identify species-specific adaptations in RNA binding and protein interaction domains

• Response to cellular perturbations:

  • Compare localization and activity changes during stress conditions

  • Assess differential phosphorylation patterns

  • Evaluate compensatory mechanisms after individual or combined depletion

  • Test for synthetic interactions through double knockdown approaches

This comparative framework provides a systems-level understanding of how SCAF1 functions within the broader context of SR protein-mediated RNA processing networks.