SFT2D2 Antibody

Shipped with Ice Packs
In Stock

Description

Biological Context of SFT2D2

SFT2D2 (UniProt ID: O95562) is a membrane-associated protein involved in retrograde vesicle transport between endocytic compartments and the Golgi apparatus . It is expressed in brain regions (prefrontal cortex, hippocampus) and immune cells (microglia, plasmacytoid dendritic cells) . Genetic studies identified rare variants (e.g., rs532193193) in SFT2D2 strongly associated with schizophrenia (OR = 1.13–1.22) .

Key Research Findings:

ParameterData from Clinical Studies Data from Preclinical Models
Target AntigenSFT2D2 N-terminal peptide (KLKKVLSGQ...)KLH-coupled SFT2D2 peptide
Assay TypeELISA (AUC = 0.803; specificity = 95%)Active immunization in ApoE⁻/⁻ mice
Pathological RoleElevated IgG in 28.6% of SCZ patientsReduced dendritic spines, glial activation
Functional ImpactOR = 1.11–1.25 for SCZ riskImpaired cognition, motor deficits
  • Clinical Utility: Anti-SFT2D2 IgG levels distinguish schizophrenia patients from controls with 95% specificity .

  • Mechanistic Insights: In ApoE⁻/⁻ mice (compromised blood-brain barrier), anti-SFT2D2 IgG induces synaptic loss, microglial activation, and psychosis-like behaviors .

Available Reagents (2025):

VendorCatalog #HostApplicationsImmunogen Sequence
Cepham Life SciencesCAC13928RabbitELISA, WB, IFRecombinant SFT2D2 (1–36AA)
Abcamab236899RabbitWB, ICC/IFSFT2D2 fragment (1–50AA)
Sigma-AldrichHPA042207RabbitIHC, WBMDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR
  • Validation: Antibodies show reactivity in human and mouse samples, with protein G purification (>95% purity) .

  • Storage: Stable at -20°C or -80°C in 50% glycerol buffer .

Pathophysiological Mechanisms

Anti-SFT2D2 antibodies may contribute to schizophrenia via:

  1. Blood-Brain Barrier Penetration: Enhanced permeability in SCZ allows IgG entry, targeting CNS SFT2D2 .

  2. Synaptic Effects: Reduced dendritic spine density in hippocampal neurons .

  3. Immune Activation:

    • Complement C4 upregulation

    • Microglial/astrocyte activation

Research Limitations

  • Sensitivity of anti-SFT2D2 ELISA remains modest (28.6%) .

  • No behavioral deficits observed in wild-type mice, suggesting BBB integrity is critical for pathogenicity .

Product Specs

Buffer
The antibody is provided in a liquid solution containing phosphate-buffered saline (PBS), 50% glycerol, 0.5% bovine serum albumin (BSA), and 0.02% sodium azide.
Form
Liquid
Lead Time
We typically ship orders within 1-3 business days of receipt. Delivery times may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Synonyms
SFT2D2; UNQ512/PRO1027; Vesicle transport protein SFT2B; SFT2 domain-containing protein 2
Target Names
SFT2D2
Uniprot No.

Target Background

Function
This antibody may play a role in the fusion of retrograde transport vesicles originating from an endocytic compartment with the Golgi complex.
Gene References Into Functions
  1. Observational study of gene-disease association (HuGE Navigator). PMID: 19536175
  2. Observational study of gene-disease association (HuGE Navigator). PMID: 19064610
Database Links

HGNC: 25140

KEGG: hsa:375035

STRING: 9606.ENSP00000271375

UniGene: Hs.645435

Protein Families
SFT2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

SFT2D2 Antibody: Frequently Asked Questions for Academic Researchers

What experimental models are suitable for studying SFT2D2’s role in neuropsychiatric disorders?

  • Animal models: ApoE-/- mice with compromised blood-brain barriers (BBB) mimic autoimmune aspects of schizophrenia. Immunization with SFT2D2 peptides induces behavioral deficits (e.g., impaired pre-pulse inhibition) and neuroinflammation .

  • Human postmortem studies: Analyze prefrontal cortex, hippocampus, and striatum tissues for SFT2D2 mRNA/protein levels, as these regions show dysregulation in schizophrenia .

  • In vitro systems: Use plasmacytoid dendritic cells (pDCs) or microglia, where SFT2D2 is highly expressed .

How do I reconcile contradictory data on SFT2D2 expression in schizophrenia?

Conflicting results may arise from:

  • Sample heterogeneity: Subtype-specific differences in schizophrenia cohorts (e.g., autoimmune vs. non-autoimmune subgroups).

  • Methodological variability:

    • ELISA protocols: In-house assays (e.g., anti-SFT2D2 IgG with AUC = 0.803 ) vs. commercial kits.

    • Tissue processing: Postmortem intervals affecting protein stability.

  • Compensatory mechanisms: Upregulation in some brain regions (e.g., prefrontal cortex ) vs. downregulation in peripheral immune cells.

What are the functional implications of anti-SFT2D2 autoantibodies in schizophrenia pathophysiology?

  • Mechanism 1: Autoantibodies cross the BBB (enhanced in ApoE-/- mice ), bind neuronal SFT2D2, and alter dendritic spine density via microglial activation .

  • Mechanism 2: Overactive SFT2D2 in pDCs disrupts immune tolerance, triggering pro-inflammatory cytokine release (e.g., IL-6, TNF-α) .

  • Therapeutic insight: ROC analysis (28.57% sensitivity, 95% specificity ) suggests anti-SFT2D2 IgG as a biomarker for patient stratification.

How can I optimize SFT2D2 antibody-based assays for low-abundance targets?

  • Signal amplification: Use tyramide-based systems in ICC/IF.

  • Pre-absorption: Remove non-specific IgG using protein A/G beads.

  • Multiplexing: Pair with markers like GFAP (astrocytes) or Iba1 (microglia) to contextualize SFT2D2 expression .

  • Quantitative WB: Normalize to housekeeping proteins (e.g., β-actin) and validate linear detection range .

What are the pitfalls in interpreting SFT2D2 antibody reactivity in autoimmune assays?

  • False positives: Cross-reactivity with bacterial/viral antigens due to molecular mimicry.

  • Epitope masking: Post-translational modifications (e.g., phosphorylation) in patient-derived samples.

  • Batch variability: Antibody lot-to-lot differences in affinity (mitigate by validating each lot ).

How does SFT2D2 interact with known schizophrenia risk genes?

  • GWAS integration: SFT2D2 lies near schizophrenia-associated loci (rs10489202, rs11586522 ).

  • Functional overlap: Dysregulated vesicle trafficking (SFT2D2’s role in Golgi fusion ) may synergize with complement pathway genes (e.g., C4 ).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.