SKIV2L Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to SKIV2L Protein

SKIV2L (Superkiller Viralicidic Activity 2-Like) is a 1,246 amino acid nuclear protein with a molecular weight of approximately 138 kDa . Also known as SKI2W, Helicase-like protein, DDX13, or simply SKIV2, this protein functions primarily as an RNA helicase with ATPase activity essential for unwinding RNA and DNA during various cellular processes . SKIV2L is encoded by a gene located on human chromosome 6p21.33, a region associated with several genetic disorders including porphyria cutanea tarda and Parkinson's disease .

As a component of the SKI complex, SKIV2L plays a crucial role in exosome-mediated RNA surveillance, including the regulation of normal mRNA and the decay of nonfunctional mRNA . The protein associates with transcriptionally active genes in a manner dependent on the PAF1 complex (PAF1C) . SKIV2L's helicase activity is particularly important for exosome recruitment and activation, making it a key player in RNA degradation pathways .

Recent research has revealed SKIV2L's significant role in innate immunity, where it acts as a moderator of antiviral defense mechanisms. The protein limits the immunogenic potential of RNA generated by the OAS-RNase L pathway, effectively regulating interferon responses and preventing excessive inflammation .

Mouse Monoclonal SKIV2L Antibodies

Mouse monoclonal antibodies offer high specificity and consistent performance across experiments. Notable examples include:

  • SKIV2L Antibody (1E5): An IgG2a κ mouse monoclonal antibody that detects SKIV2L protein from mouse, rat, and human samples by western blotting, immunoprecipitation, and ELISA .

  • 68547-1-Ig: A mouse monoclonal IgG2a antibody suitable for western blot and immunohistochemistry applications with reactivity to human samples .

Rabbit Polyclonal SKIV2L Antibodies

Rabbit polyclonal antibodies provide broader epitope recognition and potentially enhanced sensitivity:

  • 11462-1-AP: A rabbit polyclonal antibody effective in western blot, immunohistochemistry, immunofluorescence, immunoprecipitation, and ChIP applications with reactivity to human samples .

  • NBP2-47274: A BSA-free rabbit polyclonal IgG antibody developed against a recombinant protein corresponding to specific amino acids in the SKIV2L protein .

  • A04982: A rabbit polyclonal antibody raised against a 16 amino acid peptide near the amino terminus of human SKIV2L, showing reactivity to human, mouse, and rat samples .

Table 1: Comparison of Key SKIV2L Antibodies

Antibody IDHost/TypeImmunogenApplicationsSpecies ReactivityMolecular Weight Detected
1E5Mouse/MonoclonalNot specifiedWB, IP, ELISAHuman, Mouse, RatNot specified
68547-1-IgMouse/MonoclonalSKIV2L fusion proteinWB, IHC, ELISAHuman138-145 kDa
11462-1-APRabbit/PolyclonalSKIV2L fusion proteinWB, IHC, IF, IP, ChIP, ELISAHuman138 kDa
HPA051959Rabbit/PolyclonalAA sequence*WB, IF, IHCHumanNot specified
A04982Rabbit/PolyclonalN-terminal peptide (AA 60-110)ELISA, WB, IF, IHC-PHuman, Mouse, Rat68 kDa

*Immunogen sequence: LAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQ

Applications of SKIV2L Antibodies in Research

SKIV2L antibodies serve multiple experimental purposes across different techniques. The following sections detail their applications and recommended protocols.

Western Blotting (WB)

SKIV2L antibodies have been extensively validated for western blotting applications to detect the protein in various cell lysates:

  • Recommended dilutions range from 1:1000 to 1:10000 depending on the specific antibody

  • Successfully detects SKIV2L in multiple human cell lines including HEK-293, HepG2, Jurkat, MOLT-4, and NK-92 cells

  • The observed molecular weight of SKIV2L in western blots typically ranges from 138-145 kDa

Immunohistochemistry (IHC)

IHC applications reveal the tissue distribution of SKIV2L:

  • Recommended dilutions range from 1:50 to 1:4000 depending on the antibody

  • Positive IHC detection has been confirmed in human placenta, stomach, and cerebral cortex tissues

  • Antigen retrieval is typically performed with TE buffer pH 9.0, with citrate buffer pH 6.0 as an alternative

  • SKIV2L shows strong nuclear positivity in neuronal cells of the human cerebral cortex

Immunofluorescence (IF)

IF applications help visualize the subcellular localization of SKIV2L:

  • Recommended concentrations range from 0.25-2 μg/ml

  • SKIV2L has been shown to localize primarily to the nucleoplasm in human HeLa cells

  • Multiple antibodies have been validated for this application, including HPA051959 and NBP2-47274

Additional Applications

SKIV2L antibodies have also been validated for:

  • Immunoprecipitation (IP): Effective in isolating SKIV2L protein complexes

  • ELISA: Used for quantitative detection of SKIV2L

  • Chromatin Immunoprecipitation (ChIP): Applied to study SKIV2L's interaction with DNA

Recent Research Findings Using SKIV2L Antibodies

SKIV2L antibodies have facilitated significant discoveries regarding this protein's biological functions. Recent studies have particularly highlighted SKIV2L's role in innate immunity and RNA surveillance.

SKIV2L in RNA Exosome Function

SKIV2L has been identified as a critical component of the cytoplasmic RNA exosome, which degrades various RNA species. Research utilizing SKIV2L antibodies has revealed that:

  • SKIV2L acts as an RNA helicase essential for exosome recruitment and activation

  • The protein participates in the degradation of both cellular and viral RNA

  • SKIV2L may have an additional role in autophagy pathways

SKIV2L in Antiviral Defense Regulation

A groundbreaking 2024 study demonstrated SKIV2L's significant function in modulating innate antiviral responses:

  • SKIV2L limits the antiviral capacity of the OAS-RNase L pathway

  • SKIV2L-deficient cells exhibit remarkably increased interferon responses to RNase L-processed RNA, resulting in heightened antiviral activity

  • The helicase activity of SKIV2L is indispensable for its immunoregulatory function

  • SKIV2L depletion increases antiviral activity against RNA virus infections, with virus titers reduced by 20- and 66-fold at 24 and 36 hours post-infection, respectively

SKIV2L in Autoinflammatory Conditions

Research has also connected SKIV2L to autoinflammatory processes:

  • SKIV2L loss exacerbates autoinflammation caused by human OAS1 gain-of-function mutations

  • SKIV2L's role in RNA quality control makes it a potential factor in various autoimmune disorders

  • Loss-of-function mutations in SKIV2L are associated with certain pathological conditions

Technical Considerations for SKIV2L Antibody Use

Researchers should consider several factors when selecting and using SKIV2L antibodies for experimental applications.

Antibody Selection Guidelines

When choosing a SKIV2L antibody, researchers should consider:

  • Species reactivity: Most antibodies detect human SKIV2L, while some cross-react with mouse and rat

  • Isoform detection: Some antibodies detect multiple isoforms of SKIV2L

  • Application compatibility: Select antibodies validated for your specific experimental technique

  • Epitope location: Different antibodies target various regions of the SKIV2L protein

Product Specs

Buffer
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid freeze / thaw cycles.
Lead Time
Generally, we can ship your orders within 1-3 business days of receipt. Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Synonyms
SKIV2L antibody; DDX13 antibody; SKI2W antibody; SKIV2 antibody; W antibody; Helicase SKI2W antibody; Ski2 antibody; EC 3.6.4.- antibody; Helicase-like protein antibody; HLP antibody
Target Names
SKIV2L
Uniprot No.

Target Background

Function
SKIV2L is a helicase with ATPase activity. It is a component of the SKI complex, which is believed to be involved in exosome-mediated RNA decay. The SKI complex associates with transcriptionally active genes in a manner dependent on the PAF1 complex (PAF1C).
Gene References Into Functions
  1. This meta-analysis revealed a statistically significant association between SKIV2L rs429608 and age-related macular degeneration (AMD). The findings suggest that SKIV2L may have a protective effect against AMD. Further research is necessary to validate this association and elucidate the precise role of SKIV2L in AMD. PMID: 27484132
  2. This study, to our knowledge, is the first to report a case of a boy with tricho-hepato-enteric syndrome (THES) resulting from compound heterozygous mutations in the SKIV2L gene in China. PMID: 27431780
  3. This study identified three novel point mutations in the SKIV2L and TTC37 genes, which have not been previously described in other THES patients. These mutations include one nonsense, one frameshift, and one missense mutation. PMID: 27050310
  4. Data from four consanguineous families in Saudi Arabia suggest that SKIV2L mutations in THES can include deletions (c.3559_3579del, p.1187_1193del; 4 subjects) and a nonsense mutation (c.C4102T, p.Q1368X; 1 subject). [CASE REPORT] PMID: 25714577
  5. A SKIV2L variant was found to be associated with protection against exudative age-related macular degeneration, regardless of subtypes, in the Japanese population. PMID: 24865191
  6. Novel homozygous frameshift mutations in the AKR1D1 gene and the SKIV2L gene were identified in a family with severe infantile liver disease. PMID: 23679950
  7. SKIV2L is a likely causal gene for neovascular AMD, exhibiting a significant protective effect independent of CFH and HTRA1. PMID: 23260260
  8. The results demonstrate that mutations in genes encoding SKIV2L cause trichohepatoenteric syndrome, establishing a connection between defects in the human exosome complex and a Mendelian disease. PMID: 22444670
  9. A protective effect was observed at rs429608, an intronic SNP in SKIV2L. PMID: 20861866
  10. Our findings do not support a major role of the four AMD-associated variants in the risk of developing polypoidal choroidal vasculopathy (PCV), but favor a predominant association with the RDBP-SKIV2L variants. PMID: 19556007
  11. SKI2VL was found to be associated with the human exosome, a multiprotein complex involved in RNA degradation. PMID: 11719186

Show More

Hide All

Database Links

HGNC: 10898

OMIM: 600478

KEGG: hsa:6499

STRING: 9606.ENSP00000364543

UniGene: Hs.89864

Involvement In Disease
Trichohepatoenteric syndrome 2 (THES2)
Protein Families
Helicase family, SKI2 subfamily
Subcellular Location
Nucleus. Cytoplasm.

Q&A

What is SKIV2L and what are its primary biological functions?

SKIV2L is a 1,246 amino acid nuclear protein that functions primarily as an RNA helicase with essential ATPase activity. It plays a crucial role in unwinding RNA and DNA during various cellular processes, particularly in antiviral responses. SKIV2L inhibits the translation of poly(A) deficient mRNA, thereby contributing significantly to cellular defense against viral infections . Recent research has revealed that SKIV2L is a critical component of the cytoplasmic RNA exosome that specifically degrades immunogenic RNA produced by RNase L . This function positions SKIV2L as an important regulator in limiting antiviral defense mechanisms and moderating autoinflammatory responses.

The gene encoding SKIV2L is located on human chromosome 6p21.33, a region associated with several genetic disorders, including porphyria cutanea tarda and Parkinson's disease . This genomic location suggests potential broader implications of SKIV2L in both health and disease states beyond its established role in immune regulation.

What types of SKIV2L antibodies are available for research applications?

Multiple formats of SKIV2L antibodies are available for research, varying in target epitope, host species, and clonality:

Polyclonal Antibodies:

  • N-Terminal targeting antibodies (AA 60-110)

  • Middle region targeting antibodies

  • C-Terminal targeting antibodies (AA 1125-1233)

  • Full-length targeting antibodies (AA 1-1246)

Monoclonal Antibodies:

  • Clone 1E5 (targets AA 1125-1233)

Host Species Options:

  • Rabbit-derived polyclonal antibodies

  • Mouse-derived monoclonal and polyclonal antibodies

Conjugation Status:

  • Most commercially available antibodies are unconjugated, though specific applications may require custom conjugation

What species reactivity should researchers expect from SKIV2L antibodies?

SKIV2L antibodies exhibit varying species reactivity profiles that should be carefully considered when designing experiments:

  • Human-reactive: Most antibodies demonstrate strong reactivity against human SKIV2L

  • Mouse-reactive: Several antibodies, particularly polyclonal versions targeting the N-terminus, show cross-reactivity with mouse SKIV2L

  • Rat-reactive: Select antibodies demonstrate reactivity with rat SKIV2L

It's worth noting that some antibodies, such as the N-terminal targeting polyclonal antibody (AA 60-110), can detect multiple species (human, mouse, and rat), making them particularly valuable for comparative studies across species . When selecting an antibody, researchers should verify the specific reactivity profile for their experimental model system.

What are the validated applications for SKIV2L antibodies in research protocols?

SKIV2L antibodies have been validated for multiple experimental applications, each with specific considerations:

Western Blotting (WB):

  • Most SKIV2L antibodies are validated for WB applications

  • Expected molecular weight: approximately 137-140 kDa

  • Some antibodies can detect multiple isoforms of SKIV2L

Enzyme-Linked Immunosorbent Assay (ELISA):

  • Several antibodies are validated for ELISA applications

  • Particularly useful for quantitative analysis of SKIV2L expression levels

Immunofluorescence (IF):

  • Select antibodies are validated for cellular localization studies

  • Enables visualization of SKIV2L's subcellular distribution

Immunohistochemistry (IHC):

  • Some antibodies are specifically validated for paraffin-embedded sections

  • Allows for tissue-specific expression analysis

Immunoprecipitation (IP):

  • Limited antibodies have been validated for IP applications

  • Critical for studying SKIV2L protein-protein interactions

Each application requires specific optimization steps to ensure specificity and sensitivity. Researchers should consult individual antibody datasheets for detailed protocols and recommendations.

How can researchers optimize Western blotting protocols for SKIV2L detection?

Western blotting for SKIV2L requires specific optimization strategies due to its relatively high molecular weight and potential isoform detection:

Sample Preparation:

  • Cells should be lysed in RIPA or similar buffer with protease inhibitors

  • Complete protein denaturation is critical for accurate molecular weight determination

  • Both reducing and non-reducing conditions should be tested initially

Gel Selection and Transfer:

  • Use lower percentage (6-8%) polyacrylamide gels to facilitate separation of high molecular weight proteins

  • Extend transfer time to ensure complete transfer of large proteins (137-140 kDa)

  • Consider semi-dry transfer systems for higher molecular weight proteins

Antibody Dilution and Incubation:

  • Primary antibody dilutions typically range from 1:500 to 1:2000

  • Extended incubation (overnight at 4°C) often yields better results for SKIV2L detection

  • Secondary antibody selection should match host species (typically rabbit or mouse)

Controls and Verification:

  • Include positive controls from known SKIV2L-expressing cell lines

  • Consider using SKIV2L knockout cells as negative controls when available

  • Some antibodies detect both isoforms of SKIV2L, which should be accounted for in data interpretation

How can SKIV2L antibodies be implemented in immunofluorescence experiments?

Immunofluorescence studies with SKIV2L antibodies require specific technical considerations:

Fixation Methods:

  • Both paraformaldehyde (4%) and methanol fixation should be tested

  • Permeabilization conditions may require optimization (0.1-0.5% Triton X-100)

Antibody Concentration:

  • Higher concentrations than those used for Western blotting may be required

  • Typically starting with 1:100-1:500 dilutions is recommended

Subcellular Localization Expectations:

  • SKIV2L primarily localizes to the cytoplasm as part of the RNA exosome complex

  • Co-staining with RNA exosome markers can provide validation of specificity

Signal Amplification Strategies:

  • TSA (tyramide signal amplification) may enhance detection of low-abundance SKIV2L

  • Confocal microscopy is recommended to accurately resolve subcellular localization

How can SKIV2L antibodies be used to investigate antiviral immune responses?

SKIV2L antibodies serve as crucial tools in dissecting antiviral immune pathways, particularly in relation to the OAS-RNase L system:

Monitoring SKIV2L Expression Changes:

  • SKIV2L antibodies can be used to track protein levels during viral infection

  • Western blotting with SKIV2L antibodies allows quantification of expression changes in response to different viral stimuli

Co-immunoprecipitation Studies:

  • IP-capable SKIV2L antibodies facilitate identification of protein interaction partners

  • This approach has revealed critical interactions with components of the RNA exosome complex

Immunofluorescence for Localization Changes:

  • During viral infection, SKIV2L localization may shift to sites of viral replication

  • IF studies using SKIV2L antibodies can track these dynamic changes

Experimental Design Approach:

  • Establish baseline SKIV2L expression in target cells

  • Challenge cells with viral stimuli or dsRNA mimetics (e.g., poly(I:C))

  • Track changes in SKIV2L expression, localization, and protein interactions

  • Compare wild-type vs. SKIV2L-depleted conditions to assess functional outcomes

Recent research has demonstrated that SKIV2L limits the antiviral capacity of the OAS-RNase L pathway, suggesting that SKIV2L depletion could enhance antiviral responses . SKIV2L antibodies are essential for monitoring these dynamics in both in vitro and in vivo systems.

What experimental controls are critical when studying SKIV2L's role in RNA degradation pathways?

When investigating SKIV2L's function in RNA degradation pathways, several critical controls must be implemented:

Genetic Controls:

  • SKIV2L knockout cells as negative controls for antibody specificity

  • SKIV2L reconstitution experiments (wild-type vs. E424Q helicase-dead mutant)

  • Knockouts of related pathway components (e.g., TTC37, OAS1/3, RNase L, MAVS)

Functional Controls:

  • Measurement of RNA degradation efficiency using labeled RNA substrates

  • Assessment of interferon responses (e.g., IFNB1 mRNA expression)

  • Evaluation of downstream effects (e.g., cell death via Annexin V staining, Caspase 3 cleavage)

Antibody Controls:

  • Multiple antibodies targeting different epitopes should yield consistent results

  • Pre-incubation with immunizing peptide should abolish specific signals

  • IgG isotype controls should be included in all experiments

Experimental Design Table for RNA Degradation Studies:

Experimental GroupGenetic BackgroundStimulusKey MeasurementsExpected Outcome
ControlWild-typeNoneSKIV2L expression, baseline IFNBaseline levels
Stimulated ControlWild-typedsRNA (poly(I:C))SKIV2L, IFN response, cell viabilityModerate IFN response
SKIV2L KOSKIV2L-/-dsRNA (poly(I:C))IFN response, cell death markersEnhanced IFN response, increased cell death
SKIV2L + RNase L DKOSKIV2L-/- RNase L-/-dsRNA (poly(I:C))IFN response, cell death markersReduced IFN response compared to SKIV2L KO alone
ReconstitutedSKIV2L-/- + WT SKIV2LdsRNA (poly(I:C))IFN response, cell death markersRescue of wild-type phenotype
Catalytic MutantSKIV2L-/- + E424Q SKIV2LdsRNA (poly(I:C))IFN response, cell death markersFailed rescue, possible dominant negative effects

This comprehensive experimental approach enables robust evaluation of SKIV2L's specific role in RNA degradation pathways while controlling for technical and biological variables.

How does SKIV2L interact with the OAS-RNase L pathway in antiviral immunity?

SKIV2L plays a crucial regulatory role in the OAS-RNase L antiviral pathway, as evidenced by recent research:

Pathway Overview:

  • Viral dsRNA activates OAS proteins (particularly OAS3)

  • Activated OAS produces 2'-5' oligoadenylates

  • These oligoadenylates activate RNase L

  • Activated RNase L cleaves both cellular and viral RNAs

  • The cleaved RNAs can trigger RIG-I-like receptors, amplifying interferon responses

  • SKIV2L degrades these immunogenic RNAs, limiting the amplification

Key Experimental Findings:

  • SKIV2L knockout cells exhibit drastically increased (>8-fold) interferon production in response to dsRNA stimulation

  • The enhanced interferon response in SKIV2L-deficient cells is abolished when RNase L or OAS3 is also knocked out

  • The RNA helicase activity of SKIV2L (dependent on the DExH catalytic core) is essential for this regulatory function

  • SKIV2L loss enhances antiviral activity against RNA viruses in an RNase L-dependent manner

Experimental Approach for Studying this Interaction:

  • Generate single and double knockout cell lines (SKIV2L, RNase L, OAS3, MAVS)

  • Stimulate with synthetic dsRNA or viral infection

  • Measure interferon responses (mRNA and protein levels)

  • Evaluate viral replication efficiency across genotypes

  • Perform rescue experiments with wild-type and mutant SKIV2L

This systematic approach has revealed that SKIV2L specifically restricts the amplification of interferon responses downstream of RNase L activation, representing a previously unappreciated regulatory mechanism in antiviral immunity .

How can researchers interpret contradictory results between SKIV2L expression and interferon responses?

Contradictory results regarding SKIV2L expression and interferon responses may arise due to several experimental variables that require careful consideration:

Potential Sources of Contradiction:

  • Cell Type Differences:

    • SKIV2L's role may vary between immune and non-immune cells

    • Baseline expression of pathway components (OAS, RNase L) differs across cell types

  • Experimental Timing:

    • Early vs. late timepoints may show opposite effects due to feedback mechanisms

    • SKIV2L's inhibitory role becomes more prominent at later stages of response

  • Stimulus-Specific Effects:

    • Different dsRNA mimetics (poly(I:C) high vs. low molecular weight)

    • Various RNA viruses may engage different sensing pathways

  • Technical Considerations:

    • Antibody specificity issues (cross-reactivity with related helicases)

    • Incomplete SKIV2L knockdown/knockout

Resolving Contradictions - Methodological Approach:

  • Comprehensive Time Course Analysis:

    • Measure SKIV2L expression and IFN responses at multiple timepoints (2h, 6h, 12h, 24h post-stimulation)

    • Track both protein (Western blot) and mRNA (qPCR) levels simultaneously

  • Genetic Validation:

    • Compare results from siRNA knockdown vs. CRISPR knockout

    • Perform rescue experiments with wild-type and catalytically inactive SKIV2L

    • Generate double knockouts of SKIV2L with pathway components (RNase L, OAS3)

  • Multi-Parameter Assessment:

    • Beyond IFN production, measure ISG expression, cell death, and viral replication

    • This comprehensive approach may reveal stage-specific effects

Recent research has clarified that SKIV2L specifically impacts the "RNA sensing amplification loop" downstream of RNase L, rather than direct sensing of exogenous RNA . This mechanistic insight helps explain seemingly contradictory results where SKIV2L deficiency dramatically enhances some antiviral responses while having minimal impact on others.

What are common troubleshooting challenges with SKIV2L antibodies and how can they be addressed?

Researchers frequently encounter several challenges when working with SKIV2L antibodies:

Challenge 1: Weak or Absent Signal in Western Blots
Potential Solutions:

  • Increase antibody concentration or extend incubation time

  • Ensure adequate protein loading (≥50μg total protein recommended)

  • Try alternative extraction methods that better preserve high molecular weight proteins

  • Use fresh lysates, as SKIV2L may be susceptible to degradation during storage

  • Consider signal enhancement systems (e.g., enhanced chemiluminescence plus)

Challenge 2: Multiple Bands or Unexpected Molecular Weight
Potential Solutions:

  • Verify if the antibody detects known isoforms of SKIV2L (multiple isoforms have been reported)

  • Include appropriate positive control lysates from cells known to express SKIV2L

  • Use SKIV2L knockout cells as negative controls when possible

  • Try different antibodies targeting distinct epitopes for confirmation

  • Consider post-translational modifications that may alter apparent molecular weight

Challenge 3: Inconsistent Immunoprecipitation Results
Potential Solutions:

  • Not all SKIV2L antibodies are validated for IP; confirm IP capability

  • Optimize lysis conditions to preserve protein-protein interactions

  • Cross-link antibody to beads to prevent heavy chain interference

  • Consider native vs. denaturing conditions based on experimental goals

  • Pre-clear lysates thoroughly to reduce non-specific binding

Challenge 4: High Background in Immunofluorescence
Potential Solutions:

  • Implement more stringent blocking (5% BSA or 10% serum)

  • Include 0.1-0.3% Triton X-100 in antibody diluent to reduce non-specific binding

  • Reduce primary antibody concentration and extend incubation time

  • Use highly cross-adsorbed secondary antibodies

  • Consider autofluorescence quenching steps before antibody incubation

How can researchers distinguish between the functions of different SKIV2L isoforms?

Distinguishing between SKIV2L isoforms presents a methodological challenge that requires a multi-faceted approach:

Isoform Identification:

  • At least two isoforms of SKIV2L have been documented

  • Some antibodies can detect both isoforms, which must be considered in experimental design

  • The functional differences between these isoforms remain incompletely characterized

Technical Approaches for Isoform Discrimination:

  • Antibody Selection:

    • Use epitope-specific antibodies that target regions unique to specific isoforms

    • Antibodies targeting the N-terminal region (AA 60-110) may detect multiple isoforms

    • Compare results with antibodies targeting different regions of the protein

  • Genetic Manipulation:

    • Design isoform-specific siRNAs or CRISPR guides

    • Create expression constructs for individual isoforms for rescue experiments

    • Perform domain deletion/mutation studies to assess functional contributions

  • Protein Characterization:

    • Use 2D gel electrophoresis to separate isoforms based on both size and charge

    • Perform mass spectrometry analysis to identify specific isoforms

    • Assess subcellular localization patterns that may differ between isoforms

  • Functional Analysis:

    • Compare helicase activity of purified isoforms using in vitro assays

    • Assess ability of individual isoforms to rescue phenotypes in SKIV2L-deficient cells

    • Evaluate differential interactions with other components of the RNA exosome complex

This systematic approach can help researchers attribute specific functions to individual SKIV2L isoforms, advancing our understanding of this protein's diverse cellular roles.

What are promising therapeutic applications based on SKIV2L's role in antiviral immunity?

Recent discoveries about SKIV2L's function suggest several promising therapeutic directions:

Enhancing Antiviral Responses:

  • Temporary inhibition of SKIV2L could potentially boost innate antiviral immunity

  • SKIV2L inhibition specifically enhances the OAS-RNase L pathway's antiviral effects, which could be valuable against certain RNA viruses

  • Studies have shown significantly reduced viral replication (20-66 fold) in SKIV2L-deficient cells

Considerations for Therapeutic Development:

  • Complete SKIV2L inhibition might risk autoinflammatory consequences

  • Targeted, temporary inhibition during acute viral infection represents a more balanced approach

  • Organ-specific delivery systems could minimize systemic inflammatory effects

  • Combination with traditional antivirals might allow for lower doses of both agents

Methodology for Investigating Therapeutic Potential:

  • Screen for small molecule inhibitors of SKIV2L helicase activity

  • Test candidates in cellular models of viral infection

  • Evaluate both antiviral efficacy and inflammatory side effects

  • Assess specificity against related helicases to minimize off-target effects

How does SKIV2L contribute to autoinflammatory disease pathogenesis?

SKIV2L plays a significant role in regulating inflammatory responses that has implications for autoinflammatory diseases:

Key Findings:

  • SKIV2L loss exacerbates autoinflammation caused by human OAS1 gain-of-function mutations

  • Loss-of-function mutations in SKIV2L or TTC37 cause trichohepatoenteric syndrome (THE), a rare congenital bowel disorder

  • THE syndrome patients exhibit various inflammatory manifestations

Research Approaches for Studying SKIV2L in Autoinflammation:

  • Patient-Derived Cells:

    • Compare interferon signatures in cells from patients with SKIV2L mutations vs. healthy controls

    • Assess responses to inflammatory stimuli in patient-derived cells

    • Perform rescue experiments with wild-type SKIV2L to confirm causality

  • Animal Models:

    • Utilize conditional Skiv2l knockout mice to study tissue-specific effects

    • Combine with models of autoinflammatory conditions to assess disease modification

    • Evaluate inflammatory biomarkers and histopathological changes

  • Molecular Mechanisms:

    • Investigate how SKIV2L deficiency affects accumulation of endogenous immunostimulatory RNAs

    • Assess activation of downstream inflammatory pathways (NF-κB, inflammasome)

    • Evaluate potential for targeted anti-inflammatory interventions

This research direction holds particular promise for understanding and potentially treating rare genetic autoinflammatory conditions associated with SKIV2L dysfunction, as well as more common inflammatory disorders where RNA sensing pathways play contributory roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.