SKIV2L (Superkiller Viralicidic Activity 2-Like) is a 1,246 amino acid nuclear protein with a molecular weight of approximately 138 kDa . Also known as SKI2W, Helicase-like protein, DDX13, or simply SKIV2, this protein functions primarily as an RNA helicase with ATPase activity essential for unwinding RNA and DNA during various cellular processes . SKIV2L is encoded by a gene located on human chromosome 6p21.33, a region associated with several genetic disorders including porphyria cutanea tarda and Parkinson's disease .
As a component of the SKI complex, SKIV2L plays a crucial role in exosome-mediated RNA surveillance, including the regulation of normal mRNA and the decay of nonfunctional mRNA . The protein associates with transcriptionally active genes in a manner dependent on the PAF1 complex (PAF1C) . SKIV2L's helicase activity is particularly important for exosome recruitment and activation, making it a key player in RNA degradation pathways .
Recent research has revealed SKIV2L's significant role in innate immunity, where it acts as a moderator of antiviral defense mechanisms. The protein limits the immunogenic potential of RNA generated by the OAS-RNase L pathway, effectively regulating interferon responses and preventing excessive inflammation .
Mouse monoclonal antibodies offer high specificity and consistent performance across experiments. Notable examples include:
SKIV2L Antibody (1E5): An IgG2a κ mouse monoclonal antibody that detects SKIV2L protein from mouse, rat, and human samples by western blotting, immunoprecipitation, and ELISA .
68547-1-Ig: A mouse monoclonal IgG2a antibody suitable for western blot and immunohistochemistry applications with reactivity to human samples .
Rabbit polyclonal antibodies provide broader epitope recognition and potentially enhanced sensitivity:
11462-1-AP: A rabbit polyclonal antibody effective in western blot, immunohistochemistry, immunofluorescence, immunoprecipitation, and ChIP applications with reactivity to human samples .
NBP2-47274: A BSA-free rabbit polyclonal IgG antibody developed against a recombinant protein corresponding to specific amino acids in the SKIV2L protein .
A04982: A rabbit polyclonal antibody raised against a 16 amino acid peptide near the amino terminus of human SKIV2L, showing reactivity to human, mouse, and rat samples .
Table 1: Comparison of Key SKIV2L Antibodies
| Antibody ID | Host/Type | Immunogen | Applications | Species Reactivity | Molecular Weight Detected |
|---|---|---|---|---|---|
| 1E5 | Mouse/Monoclonal | Not specified | WB, IP, ELISA | Human, Mouse, Rat | Not specified |
| 68547-1-Ig | Mouse/Monoclonal | SKIV2L fusion protein | WB, IHC, ELISA | Human | 138-145 kDa |
| 11462-1-AP | Rabbit/Polyclonal | SKIV2L fusion protein | WB, IHC, IF, IP, ChIP, ELISA | Human | 138 kDa |
| HPA051959 | Rabbit/Polyclonal | AA sequence* | WB, IF, IHC | Human | Not specified |
| A04982 | Rabbit/Polyclonal | N-terminal peptide (AA 60-110) | ELISA, WB, IF, IHC-P | Human, Mouse, Rat | 68 kDa |
*Immunogen sequence: LAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQ
SKIV2L antibodies serve multiple experimental purposes across different techniques. The following sections detail their applications and recommended protocols.
SKIV2L antibodies have been extensively validated for western blotting applications to detect the protein in various cell lysates:
Recommended dilutions range from 1:1000 to 1:10000 depending on the specific antibody
Successfully detects SKIV2L in multiple human cell lines including HEK-293, HepG2, Jurkat, MOLT-4, and NK-92 cells
The observed molecular weight of SKIV2L in western blots typically ranges from 138-145 kDa
IHC applications reveal the tissue distribution of SKIV2L:
Recommended dilutions range from 1:50 to 1:4000 depending on the antibody
Positive IHC detection has been confirmed in human placenta, stomach, and cerebral cortex tissues
Antigen retrieval is typically performed with TE buffer pH 9.0, with citrate buffer pH 6.0 as an alternative
SKIV2L shows strong nuclear positivity in neuronal cells of the human cerebral cortex
IF applications help visualize the subcellular localization of SKIV2L:
SKIV2L has been shown to localize primarily to the nucleoplasm in human HeLa cells
Multiple antibodies have been validated for this application, including HPA051959 and NBP2-47274
SKIV2L antibodies have also been validated for:
Immunoprecipitation (IP): Effective in isolating SKIV2L protein complexes
Chromatin Immunoprecipitation (ChIP): Applied to study SKIV2L's interaction with DNA
SKIV2L antibodies have facilitated significant discoveries regarding this protein's biological functions. Recent studies have particularly highlighted SKIV2L's role in innate immunity and RNA surveillance.
SKIV2L has been identified as a critical component of the cytoplasmic RNA exosome, which degrades various RNA species. Research utilizing SKIV2L antibodies has revealed that:
SKIV2L acts as an RNA helicase essential for exosome recruitment and activation
The protein participates in the degradation of both cellular and viral RNA
A groundbreaking 2024 study demonstrated SKIV2L's significant function in modulating innate antiviral responses:
SKIV2L limits the antiviral capacity of the OAS-RNase L pathway
SKIV2L-deficient cells exhibit remarkably increased interferon responses to RNase L-processed RNA, resulting in heightened antiviral activity
The helicase activity of SKIV2L is indispensable for its immunoregulatory function
SKIV2L depletion increases antiviral activity against RNA virus infections, with virus titers reduced by 20- and 66-fold at 24 and 36 hours post-infection, respectively
Research has also connected SKIV2L to autoinflammatory processes:
SKIV2L loss exacerbates autoinflammation caused by human OAS1 gain-of-function mutations
SKIV2L's role in RNA quality control makes it a potential factor in various autoimmune disorders
Loss-of-function mutations in SKIV2L are associated with certain pathological conditions
Researchers should consider several factors when selecting and using SKIV2L antibodies for experimental applications.
When choosing a SKIV2L antibody, researchers should consider:
Species reactivity: Most antibodies detect human SKIV2L, while some cross-react with mouse and rat
Isoform detection: Some antibodies detect multiple isoforms of SKIV2L
Application compatibility: Select antibodies validated for your specific experimental technique
Epitope location: Different antibodies target various regions of the SKIV2L protein
SKIV2L is a 1,246 amino acid nuclear protein that functions primarily as an RNA helicase with essential ATPase activity. It plays a crucial role in unwinding RNA and DNA during various cellular processes, particularly in antiviral responses. SKIV2L inhibits the translation of poly(A) deficient mRNA, thereby contributing significantly to cellular defense against viral infections . Recent research has revealed that SKIV2L is a critical component of the cytoplasmic RNA exosome that specifically degrades immunogenic RNA produced by RNase L . This function positions SKIV2L as an important regulator in limiting antiviral defense mechanisms and moderating autoinflammatory responses.
The gene encoding SKIV2L is located on human chromosome 6p21.33, a region associated with several genetic disorders, including porphyria cutanea tarda and Parkinson's disease . This genomic location suggests potential broader implications of SKIV2L in both health and disease states beyond its established role in immune regulation.
Multiple formats of SKIV2L antibodies are available for research, varying in target epitope, host species, and clonality:
Polyclonal Antibodies:
Monoclonal Antibodies:
Host Species Options:
Conjugation Status:
Most commercially available antibodies are unconjugated, though specific applications may require custom conjugation
SKIV2L antibodies exhibit varying species reactivity profiles that should be carefully considered when designing experiments:
Human-reactive: Most antibodies demonstrate strong reactivity against human SKIV2L
Mouse-reactive: Several antibodies, particularly polyclonal versions targeting the N-terminus, show cross-reactivity with mouse SKIV2L
Rat-reactive: Select antibodies demonstrate reactivity with rat SKIV2L
It's worth noting that some antibodies, such as the N-terminal targeting polyclonal antibody (AA 60-110), can detect multiple species (human, mouse, and rat), making them particularly valuable for comparative studies across species . When selecting an antibody, researchers should verify the specific reactivity profile for their experimental model system.
SKIV2L antibodies have been validated for multiple experimental applications, each with specific considerations:
Western Blotting (WB):
Expected molecular weight: approximately 137-140 kDa
Enzyme-Linked Immunosorbent Assay (ELISA):
Particularly useful for quantitative analysis of SKIV2L expression levels
Immunofluorescence (IF):
Select antibodies are validated for cellular localization studies
Enables visualization of SKIV2L's subcellular distribution
Immunohistochemistry (IHC):
Some antibodies are specifically validated for paraffin-embedded sections
Allows for tissue-specific expression analysis
Immunoprecipitation (IP):
Critical for studying SKIV2L protein-protein interactions
Each application requires specific optimization steps to ensure specificity and sensitivity. Researchers should consult individual antibody datasheets for detailed protocols and recommendations.
Western blotting for SKIV2L requires specific optimization strategies due to its relatively high molecular weight and potential isoform detection:
Sample Preparation:
Cells should be lysed in RIPA or similar buffer with protease inhibitors
Complete protein denaturation is critical for accurate molecular weight determination
Both reducing and non-reducing conditions should be tested initially
Gel Selection and Transfer:
Use lower percentage (6-8%) polyacrylamide gels to facilitate separation of high molecular weight proteins
Extend transfer time to ensure complete transfer of large proteins (137-140 kDa)
Consider semi-dry transfer systems for higher molecular weight proteins
Antibody Dilution and Incubation:
Primary antibody dilutions typically range from 1:500 to 1:2000
Extended incubation (overnight at 4°C) often yields better results for SKIV2L detection
Secondary antibody selection should match host species (typically rabbit or mouse)
Controls and Verification:
Include positive controls from known SKIV2L-expressing cell lines
Consider using SKIV2L knockout cells as negative controls when available
Some antibodies detect both isoforms of SKIV2L, which should be accounted for in data interpretation
Immunofluorescence studies with SKIV2L antibodies require specific technical considerations:
Fixation Methods:
Both paraformaldehyde (4%) and methanol fixation should be tested
Permeabilization conditions may require optimization (0.1-0.5% Triton X-100)
Antibody Concentration:
Higher concentrations than those used for Western blotting may be required
Typically starting with 1:100-1:500 dilutions is recommended
Subcellular Localization Expectations:
SKIV2L primarily localizes to the cytoplasm as part of the RNA exosome complex
Co-staining with RNA exosome markers can provide validation of specificity
Signal Amplification Strategies:
TSA (tyramide signal amplification) may enhance detection of low-abundance SKIV2L
Confocal microscopy is recommended to accurately resolve subcellular localization
SKIV2L antibodies serve as crucial tools in dissecting antiviral immune pathways, particularly in relation to the OAS-RNase L system:
Monitoring SKIV2L Expression Changes:
SKIV2L antibodies can be used to track protein levels during viral infection
Western blotting with SKIV2L antibodies allows quantification of expression changes in response to different viral stimuli
Co-immunoprecipitation Studies:
IP-capable SKIV2L antibodies facilitate identification of protein interaction partners
This approach has revealed critical interactions with components of the RNA exosome complex
Immunofluorescence for Localization Changes:
During viral infection, SKIV2L localization may shift to sites of viral replication
IF studies using SKIV2L antibodies can track these dynamic changes
Experimental Design Approach:
Establish baseline SKIV2L expression in target cells
Challenge cells with viral stimuli or dsRNA mimetics (e.g., poly(I:C))
Track changes in SKIV2L expression, localization, and protein interactions
Compare wild-type vs. SKIV2L-depleted conditions to assess functional outcomes
Recent research has demonstrated that SKIV2L limits the antiviral capacity of the OAS-RNase L pathway, suggesting that SKIV2L depletion could enhance antiviral responses . SKIV2L antibodies are essential for monitoring these dynamics in both in vitro and in vivo systems.
When investigating SKIV2L's function in RNA degradation pathways, several critical controls must be implemented:
Genetic Controls:
SKIV2L knockout cells as negative controls for antibody specificity
SKIV2L reconstitution experiments (wild-type vs. E424Q helicase-dead mutant)
Knockouts of related pathway components (e.g., TTC37, OAS1/3, RNase L, MAVS)
Functional Controls:
Measurement of RNA degradation efficiency using labeled RNA substrates
Assessment of interferon responses (e.g., IFNB1 mRNA expression)
Evaluation of downstream effects (e.g., cell death via Annexin V staining, Caspase 3 cleavage)
Antibody Controls:
Multiple antibodies targeting different epitopes should yield consistent results
Pre-incubation with immunizing peptide should abolish specific signals
Experimental Design Table for RNA Degradation Studies:
This comprehensive experimental approach enables robust evaluation of SKIV2L's specific role in RNA degradation pathways while controlling for technical and biological variables.
SKIV2L plays a crucial regulatory role in the OAS-RNase L antiviral pathway, as evidenced by recent research:
Pathway Overview:
Viral dsRNA activates OAS proteins (particularly OAS3)
Activated OAS produces 2'-5' oligoadenylates
These oligoadenylates activate RNase L
Activated RNase L cleaves both cellular and viral RNAs
The cleaved RNAs can trigger RIG-I-like receptors, amplifying interferon responses
SKIV2L degrades these immunogenic RNAs, limiting the amplification
Key Experimental Findings:
SKIV2L knockout cells exhibit drastically increased (>8-fold) interferon production in response to dsRNA stimulation
The enhanced interferon response in SKIV2L-deficient cells is abolished when RNase L or OAS3 is also knocked out
The RNA helicase activity of SKIV2L (dependent on the DExH catalytic core) is essential for this regulatory function
SKIV2L loss enhances antiviral activity against RNA viruses in an RNase L-dependent manner
Experimental Approach for Studying this Interaction:
Generate single and double knockout cell lines (SKIV2L, RNase L, OAS3, MAVS)
Stimulate with synthetic dsRNA or viral infection
Measure interferon responses (mRNA and protein levels)
Evaluate viral replication efficiency across genotypes
Perform rescue experiments with wild-type and mutant SKIV2L
This systematic approach has revealed that SKIV2L specifically restricts the amplification of interferon responses downstream of RNase L activation, representing a previously unappreciated regulatory mechanism in antiviral immunity .
Contradictory results regarding SKIV2L expression and interferon responses may arise due to several experimental variables that require careful consideration:
Potential Sources of Contradiction:
Cell Type Differences:
SKIV2L's role may vary between immune and non-immune cells
Baseline expression of pathway components (OAS, RNase L) differs across cell types
Experimental Timing:
Stimulus-Specific Effects:
Different dsRNA mimetics (poly(I:C) high vs. low molecular weight)
Various RNA viruses may engage different sensing pathways
Technical Considerations:
Antibody specificity issues (cross-reactivity with related helicases)
Incomplete SKIV2L knockdown/knockout
Resolving Contradictions - Methodological Approach:
Comprehensive Time Course Analysis:
Measure SKIV2L expression and IFN responses at multiple timepoints (2h, 6h, 12h, 24h post-stimulation)
Track both protein (Western blot) and mRNA (qPCR) levels simultaneously
Genetic Validation:
Multi-Parameter Assessment:
Beyond IFN production, measure ISG expression, cell death, and viral replication
This comprehensive approach may reveal stage-specific effects
Recent research has clarified that SKIV2L specifically impacts the "RNA sensing amplification loop" downstream of RNase L, rather than direct sensing of exogenous RNA . This mechanistic insight helps explain seemingly contradictory results where SKIV2L deficiency dramatically enhances some antiviral responses while having minimal impact on others.
Researchers frequently encounter several challenges when working with SKIV2L antibodies:
Challenge 1: Weak or Absent Signal in Western Blots
Potential Solutions:
Increase antibody concentration or extend incubation time
Ensure adequate protein loading (≥50μg total protein recommended)
Try alternative extraction methods that better preserve high molecular weight proteins
Use fresh lysates, as SKIV2L may be susceptible to degradation during storage
Consider signal enhancement systems (e.g., enhanced chemiluminescence plus)
Challenge 2: Multiple Bands or Unexpected Molecular Weight
Potential Solutions:
Verify if the antibody detects known isoforms of SKIV2L (multiple isoforms have been reported)
Include appropriate positive control lysates from cells known to express SKIV2L
Use SKIV2L knockout cells as negative controls when possible
Try different antibodies targeting distinct epitopes for confirmation
Consider post-translational modifications that may alter apparent molecular weight
Challenge 3: Inconsistent Immunoprecipitation Results
Potential Solutions:
Not all SKIV2L antibodies are validated for IP; confirm IP capability
Optimize lysis conditions to preserve protein-protein interactions
Cross-link antibody to beads to prevent heavy chain interference
Consider native vs. denaturing conditions based on experimental goals
Pre-clear lysates thoroughly to reduce non-specific binding
Challenge 4: High Background in Immunofluorescence
Potential Solutions:
Implement more stringent blocking (5% BSA or 10% serum)
Include 0.1-0.3% Triton X-100 in antibody diluent to reduce non-specific binding
Reduce primary antibody concentration and extend incubation time
Use highly cross-adsorbed secondary antibodies
Consider autofluorescence quenching steps before antibody incubation
Distinguishing between SKIV2L isoforms presents a methodological challenge that requires a multi-faceted approach:
Isoform Identification:
Some antibodies can detect both isoforms, which must be considered in experimental design
The functional differences between these isoforms remain incompletely characterized
Technical Approaches for Isoform Discrimination:
Antibody Selection:
Genetic Manipulation:
Design isoform-specific siRNAs or CRISPR guides
Create expression constructs for individual isoforms for rescue experiments
Perform domain deletion/mutation studies to assess functional contributions
Protein Characterization:
Use 2D gel electrophoresis to separate isoforms based on both size and charge
Perform mass spectrometry analysis to identify specific isoforms
Assess subcellular localization patterns that may differ between isoforms
Functional Analysis:
Compare helicase activity of purified isoforms using in vitro assays
Assess ability of individual isoforms to rescue phenotypes in SKIV2L-deficient cells
Evaluate differential interactions with other components of the RNA exosome complex
This systematic approach can help researchers attribute specific functions to individual SKIV2L isoforms, advancing our understanding of this protein's diverse cellular roles.
Recent discoveries about SKIV2L's function suggest several promising therapeutic directions:
Enhancing Antiviral Responses:
Temporary inhibition of SKIV2L could potentially boost innate antiviral immunity
SKIV2L inhibition specifically enhances the OAS-RNase L pathway's antiviral effects, which could be valuable against certain RNA viruses
Studies have shown significantly reduced viral replication (20-66 fold) in SKIV2L-deficient cells
Considerations for Therapeutic Development:
Complete SKIV2L inhibition might risk autoinflammatory consequences
Targeted, temporary inhibition during acute viral infection represents a more balanced approach
Organ-specific delivery systems could minimize systemic inflammatory effects
Combination with traditional antivirals might allow for lower doses of both agents
Methodology for Investigating Therapeutic Potential:
Screen for small molecule inhibitors of SKIV2L helicase activity
Test candidates in cellular models of viral infection
Evaluate both antiviral efficacy and inflammatory side effects
Assess specificity against related helicases to minimize off-target effects
SKIV2L plays a significant role in regulating inflammatory responses that has implications for autoinflammatory diseases:
Key Findings:
SKIV2L loss exacerbates autoinflammation caused by human OAS1 gain-of-function mutations
Loss-of-function mutations in SKIV2L or TTC37 cause trichohepatoenteric syndrome (THE), a rare congenital bowel disorder
THE syndrome patients exhibit various inflammatory manifestations
Research Approaches for Studying SKIV2L in Autoinflammation:
Patient-Derived Cells:
Compare interferon signatures in cells from patients with SKIV2L mutations vs. healthy controls
Assess responses to inflammatory stimuli in patient-derived cells
Perform rescue experiments with wild-type SKIV2L to confirm causality
Animal Models:
Utilize conditional Skiv2l knockout mice to study tissue-specific effects
Combine with models of autoinflammatory conditions to assess disease modification
Evaluate inflammatory biomarkers and histopathological changes
Molecular Mechanisms:
Investigate how SKIV2L deficiency affects accumulation of endogenous immunostimulatory RNAs
Assess activation of downstream inflammatory pathways (NF-κB, inflammasome)
Evaluate potential for targeted anti-inflammatory interventions
This research direction holds particular promise for understanding and potentially treating rare genetic autoinflammatory conditions associated with SKIV2L dysfunction, as well as more common inflammatory disorders where RNA sensing pathways play contributory roles.