SLC22A15 Antibody

What is SLC22A15 and why is it an important research target?

SLC22A15 (solute carrier family 22 member 15) is a membrane protein belonging to the organic cation transporter family. It functions primarily in the transport of organic cations and anti-oxidant zwitterions across cell membranes . This protein is of significant research interest because:

• It exhibits high expression levels in kidney and brain tissues

• It plays a documented role in cell proliferation processes

• It belongs to a transporter family involved in the movement of pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites

• Its dysregulation may be associated with various pathological conditions

The canonical human form consists of 547 amino acid residues with a molecular weight of approximately 60.5 kDa, though alternative splicing can produce at least two distinct isoforms .

What applications are SLC22A15 antibodies typically used for?

SLC22A15 antibodies have been validated for multiple research applications, including:

Researchers should note that optimal dilutions and protocols may vary between different antibody products and experimental systems, requiring optimization for each specific application .

Which tissues show significant expression of SLC22A15 for antibody validation?

When validating SLC22A15 antibodies, researchers should consider targeting tissues with documented expression:

• Highest expression: Kidney and brain tissues

• Moderate expression: Heart, skeletal muscle, and placenta

• Cell lines with detectable expression: HEK-293, A431, and L02 cells

Validation experiments have demonstrated successful detection of SLC22A15 in human brain tissue, heart tissue, placenta tissue, and skeletal muscle tissue , making these optimal positive control samples for antibody validation studies.

What is the subcellular localization of SLC22A15 and how does this impact immunostaining protocols?

SLC22A15 is primarily localized to the cell membrane , which has important implications for immunostaining protocols:

• Membrane permeabilization should be carefully optimized to expose epitopes while preserving membrane structure

• Fixation protocols that preserve membrane proteins (e.g., paraformaldehyde) are preferred over those that extensively disrupt membranes

• When performing subcellular fractionation, membrane fraction enrichment techniques are recommended for optimal detection

• Confocal microscopy with membrane markers can help confirm proper localization patterns

Special attention to blocking protocols is also necessary to reduce non-specific binding to membrane components.

How do post-translational modifications of SLC22A15 affect antibody binding and experimental design?

SLC22A15 undergoes several post-translational modifications, notably glycosylation , which can significantly impact antibody recognition:

• Glycosylation may mask epitopes or create steric hindrance for antibody binding

• The observed molecular weight on Western blots may appear higher than predicted (61-66 kDa observed vs. 59-61 kDa calculated)

• Researchers working with deglycosylation enzymes (PNGase F, Endo H) should monitor changes in apparent molecular weight and antibody recognition

• Epitope-specific antibodies targeting non-modified regions may provide more consistent results across different experimental conditions

When designing experiments, researchers should consider whether their selected antibody targets regions affected by known post-translational modifications and adjust protocols accordingly.

What strategies can resolve discrepancies in SLC22A15 detection between different antibodies?

Researchers often encounter discrepancies when using different SLC22A15 antibodies. To resolve these issues:

• Compare immunogen sequences between antibodies to understand epitope differences

  • Example: Some SLC22A15 antibodies target the sequence "ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR"

  • Others may target the middle region of the protein

• Implement validation controls:

  • Use recombinant SLC22A15 protein as a positive control

  • Include siRNA/shRNA knockdown samples as specificity controls

  • Compare multiple antibodies targeting different epitopes

  • Include tissue samples known to be negative for SLC22A15 expression

• Optimize detection conditions based on epitope accessibility:

  • Adjust denaturation conditions for Western blots based on epitope location

  • Modify antigen retrieval protocols for IHC based on epitope characteristics

  • Consider alternative fixation methods that may better preserve specific epitopes

How can researchers distinguish between SLC22A15 isoforms using antibodies?

SLC22A15 is reported to have at least two isoforms generated through alternative splicing , presenting challenges for specific detection:

• Isoform mapping strategy:

  • Analyze predicted sequences of both isoforms to identify unique regions

  • Select antibodies whose epitopes can discriminate between isoforms

  • Design PCR primers targeting isoform-specific junctions to correlate with antibody detection

• Recommended experimental approach:

  • Use isoform-specific antibodies when available

  • Employ high-resolution gel electrophoresis to separate closely migrating isoforms

  • Consider 2D gel electrophoresis to separate isoforms based on both size and charge

  • Validate with recombinant expression of individual isoforms

• Data interpretation considerations:

  • Document precise band patterns observed across different tissues

  • Correlate protein detection with isoform-specific transcript analysis

  • Consider that isoform abundance may vary across different tissues and pathological states

What are the critical considerations when studying SLC22A15 function in relation to other SLC22 family members?

The SLC22 family contains multiple related transporters with overlapping functions and expression patterns . When designing experiments to study SLC22A15 specifically:

• Selectivity considerations:

  • Verify antibody cross-reactivity against other SLC22 family members, particularly those with high sequence homology

  • Include appropriate controls expressing other SLC22 family proteins

  • Consider protein array validation data that tests cross-reactivity

• Functional discrimination approaches:

  • Design transport assays with substrates specific to SLC22A15 (anti-oxidant zwitterions)

  • Utilize selective inhibitors when available

  • Implement genetic approaches (CRISPR, siRNA) targeting unique sequences

• Expression pattern analysis:

  • Compare expression patterns with other SLC22 family members to identify unique vs. overlapping expression domains

  • Consider compensatory expression changes of other family members in knockout/knockdown models

What are the optimal protocols for Western blot detection of SLC22A15?

For reliable Western blot detection of SLC22A15:

• Sample preparation:

  • Use RIPA or NP-40 based lysis buffers supplemented with protease inhibitors

  • Include phosphatase inhibitors if phosphorylation status is relevant

  • Sonicate briefly to shear DNA and reduce sample viscosity

• Optimal conditions:

  • Load 20-50 μg of total protein per lane

  • Use 8-10% polyacrylamide gels for optimal resolution around 60-66 kDa

  • Transfer to PVDF membranes (preferred over nitrocellulose for hydrophobic membrane proteins)

  • Block with 5% non-fat milk or BSA in TBST

• Antibody application:

  • Primary antibody dilutions typically range from 1:500-1:3000

  • Incubate overnight at 4°C for optimal sensitivity

  • Use HRP-conjugated secondary antibodies at 1:5000-1:10000

  • Consider enhanced chemiluminescence detection systems for optimal sensitivity

• Expected results:

  • Anticipated band size: 61-66 kDa

  • Positive control samples: HEK-293 cells, A431 cells, human brain tissue

How should researchers optimize immunohistochemistry protocols for SLC22A15 detection in different tissues?

For successful immunohistochemical detection of SLC22A15:

• Tissue preparation considerations:

  • Both formalin-fixed paraffin-embedded (FFPE) and frozen sections can be used

  • Fixation time should be optimized (typically 24-48 hours for FFPE)

  • Section thickness of 4-6 μm is recommended

• Antigen retrieval optimization:

  • Test both heat-induced epitope retrieval (HIER) methods:

    • Citrate buffer (pH 6.0)

    • EDTA buffer (pH 9.0)

  • Pressure cooker methods often yield superior results for membrane proteins

• Detection protocol:

  • Initial antibody dilution range: 1:50-1:200

  • Incubation conditions: overnight at 4°C or 1-2 hours at room temperature

  • Secondary detection systems: HRP-polymer or ABC methods both suitable

  • Counterstain with hematoxylin for nuclear visualization

• Validation controls:

  • Positive tissue controls: kidney, brain, heart tissue

  • Negative controls: omit primary antibody

  • Absorption controls: pre-incubate antibody with immunizing peptide when available

What strategies can improve reproducibility when using SLC22A15 antibodies across different experimental platforms?

To enhance reproducibility when working with SLC22A15 antibodies:

• Antibody validation checklist:

  • Verify lot-to-lot consistency through standardized positive controls

  • Document specific epitope recognition and potential cross-reactivity

  • Maintain consistent antibody storage conditions (-20°C, avoid freeze-thaw cycles)

  • Consider purchasing larger antibody lots for long-term projects

• Protocol standardization:

  • Develop detailed SOPs for each application

  • Control for variables such as fixation time, antigen retrieval duration, and antibody incubation conditions

  • Implement quality control checkpoints throughout protocols

  • Document reagent sources, lot numbers, and expiration dates

• Multi-platform confirmation:

  • Validate findings using at least two different techniques (e.g., WB and IHC)

  • Consider orthogonal approaches (e.g., RNA expression, functional assays)

  • Quantify signal-to-noise ratios across different platforms

  • Establish quantification standards appropriate for each technique

What are the best approaches for studying SLC22A15 expression in relation to its function as a transporter?

To correlate SLC22A15 expression with its transport function:

• Expression analysis strategy:

  • Combine protein detection (antibody-based) with mRNA quantification

  • Consider single-cell approaches to account for cellular heterogeneity

  • Use subcellular fractionation to confirm membrane localization

  • Quantify surface expression using biotinylation assays or flow cytometry

• Functional correlation methods:

  • Implement transport assays using fluorescent or radiolabeled substrates

  • Correlate transport activity with protein expression levels

  • Use inducible expression systems to titrate protein levels and measure corresponding activity

  • Consider studying transport kinetics in relation to expression levels

• Disease model applications:

  • Compare expression and function in normal versus pathological states

  • Assess impact of SLC22A15 variants on expression and function

  • Study correlation between expression levels and transport of physiologically relevant compounds

  • Investigate potential compensatory mechanisms when SLC22A15 function is altered

How can researchers address common issues with SLC22A15 antibody specificity?

To resolve specificity issues with SLC22A15 antibodies:

• Identifying non-specific binding:

  • Run knockout/knockdown controls whenever possible

  • Test antibody on protein arrays containing multiple targets

  • Compare detection patterns across multiple antibodies targeting different epitopes

  • Verify that molecular weight matches prediction (accounting for post-translational modifications)

• Optimizing blocking conditions:

  • Test different blocking agents (BSA, non-fat milk, normal serum)

  • Adjust blocking time and temperature

  • Consider adding detergents (0.1-0.3% Triton X-100) to reduce hydrophobic interactions

  • Pre-absorb antibodies with tissue lysates known to lack SLC22A15 expression

• Validation approaches:

  • Perform peptide competition assays using the immunizing peptide

  • Correlate protein detection with mRNA expression across tissues

  • Consider mass spectrometry validation of detected bands

  • Document all validation steps in publications and protocols

What are the appropriate storage and handling conditions to maintain SLC22A15 antibody integrity?

To preserve antibody function and extend shelf life:

• Storage recommendations:

  • Store at -20°C for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • For short-term use (within 1 week), 4°C storage is acceptable

  • Some antibodies are supplied in glycerol buffers (e.g., PBS with 0.02% sodium azide and 50% glycerol, pH 7.3)

• Handling best practices:

  • Allow antibody to reach room temperature before opening to prevent condensation

  • Centrifuge briefly before opening vials

  • Use clean pipette tips for each handling

  • Return to storage promptly after use

• Stability monitoring:

  • Include positive controls with each experiment to track performance over time

  • Document lot numbers and performance characteristics

  • Set up quality control standards to identify deterioration

  • Consider establishing new working dilutions if performance changes

How can researchers distinguish between true SLC22A15 signals and technical artifacts?

To differentiate genuine SLC22A15 signals from artifacts:

• Technical control panel:

  • Include no-primary antibody controls

  • Test antibody on tissues known to be negative for SLC22A15

  • Compare staining patterns between different detection methods

  • Validate with orthogonal detection techniques (RNA analysis, functional assays)

• Common artifact identification:

  • Edge effects: increased signal at tissue margins

  • Necrotic tissue: non-specific binding to damaged cells

  • Cross-reactivity: signal in tissues known to lack SLC22A15

  • Background: diffuse signal not correlating with expected subcellular localization

• Signal verification approaches:

  • Compare with in situ hybridization data when available

  • Use gene expression databases to correlate detection with expected expression patterns

  • Implement dual labeling with markers of expected subcellular compartments

  • Consider quantitative imaging analysis to distinguish specific from non-specific signals