SLC25A34 Antibody

What is SLC25A34 and why is it important in research?

SLC25A34 (solute carrier family 25 member 34) is a mitochondrial carrier protein localized to the inner mitochondrial membrane. In humans, the canonical protein has 304 amino acid residues with a molecular weight of approximately 32.2 kDa . It belongs to the mitochondrial carrier (TC 2.A.29) protein family. The importance of SLC25A34 in research stems from its potential role in mitochondrial metabolism and recent associations with certain cancer types. Recent bioinformatic investigations have suggested that SLC25A34 expression may have prognostic significance in some cancers, making it a protein of interest for both basic metabolism research and potential clinical applications .

What are the key characteristics of SLC25A34 antibodies?

SLC25A34 antibodies are primarily available as rabbit polyclonal antibodies that target various epitopes of the protein. These antibodies have been validated for multiple applications including Western Blot (WB), ELISA, Immunocytochemistry (ICC), and Immunoprecipitation (IP) . The specificity of these antibodies varies across species, with many showing reactivity to human, mouse, and rat SLC25A34 . Most commercial antibodies are unconjugated and purified using antigen affinity chromatography methods . The immunogens used to develop these antibodies often correspond to specific amino acid sequences within the human SLC25A34 protein, with some targeting the full-length protein while others target specific regions such as the middle region or internal segments .

What is the amino acid sequence of human SLC25A34?

The full amino acid sequence of human SLC25A34 is as follows:

METVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAA VARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGTVVAGAVAGALGAF VGSPAYLIKTQLQAQTVAAVAVGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMV GSAAQLATFASAKAWVQKQQWLPEDSWLVALAGGMISSIAVVVVMTPFDVVSTRLYNQPV DTAGRGQLYGGLTDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRA QHKGT

This sequence is critical for researchers developing or selecting antibodies, as the epitope recognition depends on specific regions within this sequence. Most commercial antibodies target conserved regions within this sequence to ensure cross-reactivity across multiple species.

What are the optimal conditions for using SLC25A34 antibodies in Western Blot applications?

For Western Blot applications, SLC25A34 antibodies typically perform optimally under the following conditions:

• Sample preparation: Mitochondrial enrichment is recommended for enhanced detection as SLC25A34 is a mitochondrial protein.

• Dilution range: Most SLC25A34 antibodies work effectively at dilutions between 1:500 to 1:3000, though the optimal dilution should be determined experimentally for each specific antibody .

• Detection system: Secondary antibodies against rabbit IgG conjugated with HRP or fluorescent dyes provide good results.

• Expected band size: The observed molecular weight on Western Blots is approximately 32 kDa, consistent with the calculated molecular weight of the protein .

• Positive controls: HepG2 cells and human liver tissue have been confirmed to express detectable levels of SLC25A34 and serve as excellent positive controls .

For best results, researchers should optimize blocking conditions (typically 5% non-fat milk or BSA in TBST) and incubation times based on their specific experimental setup and antibody concentration.

How can I validate the specificity of an SLC25A34 antibody?

Validating the specificity of an SLC25A34 antibody is crucial for reliable experimental results. A comprehensive validation approach includes:

• Positive and negative controls: Use tissues/cells known to express (HepG2 cells, human liver) or not express SLC25A34.

• Knockdown/knockout validation: Verify antibody specificity by comparing detection in wild-type versus SLC25A34 knockdown or knockout samples.

• Peptide competition assay: Pre-incubate the antibody with the immunizing peptide before application to confirm specific binding.

• Cross-reactivity assessment: Test the antibody against related proteins, particularly other members of the SLC25 family, to ensure specificity.

• Multiple application testing: Confirm consistent results across different applications (WB, IHC, IF) where possible.

Some manufacturers provide validation data showing specificity against arrays containing the target protein plus 383 other non-specific proteins, offering an additional level of confidence in antibody specificity .

What are the recommended protocols for SLC25A34 immunoprecipitation experiments?

For successful immunoprecipitation of SLC25A34, follow these methodological guidelines:

• Antibody amount: Use 0.5-4.0 μg of SLC25A34 antibody for 1.0-3.0 mg of total protein lysate .

• Lysis buffer composition: A buffer containing 1% NP-40 or Triton X-100, 150 mM NaCl, 50 mM Tris-HCl (pH 7.5), and protease inhibitors works well for extracting SLC25A34 while maintaining antibody-antigen interactions.

• Pre-clearing step: Pre-clear lysates with protein A/G beads to reduce non-specific binding.

• Antibody incubation: Incubate the antibody with the lysate overnight at 4°C with gentle rotation.

• Washing conditions: Perform 3-5 washes with cold lysis buffer containing reduced detergent concentration (0.1-0.5%).

• Elution method: Elute using either low pH buffer or by boiling in SDS-PAGE sample buffer.

• Verification: Confirm successful immunoprecipitation by Western Blot analysis using a different SLC25A34 antibody if available, or the same antibody for detection.

HepG2 cells have been validated as a suitable positive control for SLC25A34 immunoprecipitation experiments .

How can SLC25A34 antibodies be utilized in cancer research?

Recent bioinformatic investigations have revealed potential roles for SLC25A family members, including SLC25A34, in cancer biology. Researchers can leverage SLC25A34 antibodies in cancer research through the following approaches:

• Expression profiling: Analyze SLC25A34 expression across different cancer types and stages using IHC or Western Blot to identify correlations with disease progression or patient outcomes.

• Prognostic marker assessment: Investigate the potential of SLC25A34 as a prognostic marker. Some research indicates that expression levels of certain SLC25 family members may correlate with patient survival in colon cancer .

• Mechanistic studies: Examine the role of SLC25A34 in mitochondrial metabolism alterations during carcinogenesis, particularly in cancers with known metabolic reprogramming.

• Drug response correlation: Study how SLC25A34 expression levels relate to sensitivity or resistance to specific anticancer drugs, similar to findings for other SLC25 family members .

• Immune infiltration correlation: Investigate potential relationships between SLC25A34 expression and tumor immune infiltration, as has been demonstrated for other SLC25 family members .

When conducting cancer research using SLC25A34 antibodies, researchers should employ multiple detection methods and carefully validate findings using genetic approaches (knockdown/overexpression) to confirm antibody-based observations.

What approaches can address cross-reactivity concerns with SLC25A34 antibodies?

Cross-reactivity is a significant concern with antibodies targeting members of large protein families like SLC25. To address cross-reactivity concerns with SLC25A34 antibodies:

• Epitope selection analysis: Review the immunogen sequence used to generate the antibody and perform BLAST analyses to identify potential cross-reactive proteins within the SLC25 family.

• Multiple antibody approach: Use antibodies targeting different epitopes of SLC25A34 to confirm consistent results.

• Genetic validation: Implement CRISPR/Cas9 or siRNA knockdown of SLC25A34 to confirm antibody specificity through signal reduction or elimination.

• Recombinant protein controls: Include purified recombinant SLC25A34 as a positive control and related SLC25 family members as negative controls to assess cross-reactivity.

• Mass spectrometry validation: Perform immunoprecipitation followed by mass spectrometry to identify all proteins captured by the antibody.

• Pre-adsorption controls: Pre-incubate antibodies with recombinant SLC25A34 and related proteins to assess and eliminate cross-reactive antibody populations.

• Species-specific considerations: Be aware that cross-reactivity profiles may differ across species, even with the same antibody.

Some manufacturers provide specificity data from protein arrays containing target protein plus 383 other non-specific proteins , which can help inform selection of antibodies with minimal cross-reactivity.

How can SLC25A34 antibodies be integrated into multi-parameter analyses of mitochondrial function?

Integrating SLC25A34 antibodies into comprehensive mitochondrial function analyses requires sophisticated experimental design:

• Co-localization studies: Combine SLC25A34 antibodies with markers for different mitochondrial compartments (outer membrane, matrix) to precisely localize SLC25A34 within mitochondria using super-resolution microscopy techniques.

• Functional protein complexes: Use SLC25A34 antibodies in proximity ligation assays or co-immunoprecipitation experiments to identify interaction partners within the mitochondrial transport machinery.

• Metabolic flux correlation: Correlate SLC25A34 expression or localization with measurements of mitochondrial metabolite transport using isotope tracing methods.

• Dynamic regulation assessment: Analyze changes in SLC25A34 expression, post-translational modifications, or localization in response to metabolic stress, using antibodies specific to different modified forms of the protein.

• Integration with proteomics: Combine antibody-based detection with quantitative proteomics approaches to place SLC25A34 within the broader context of mitochondrial protein networks.

• Tissue-specific expression patterns: Map SLC25A34 expression across different tissues with varying metabolic profiles to infer potential tissue-specific functions.

This multi-parameter approach can provide insights into the specific role of SLC25A34 in mitochondrial metabolism and how it may be altered in disease states.

How should unexpected molecular weight bands in SLC25A34 Western Blots be interpreted?

When encountering unexpected bands when using SLC25A34 antibodies in Western Blots, consider these possible explanations and troubleshooting approaches:

The expected molecular weight of human SLC25A34 is approximately 32 kDa . When troubleshooting, always include a positive control (such as HepG2 cell lysate) where SLC25A34 has been confirmed to be expressed .

What quality control parameters should be evaluated when selecting SLC25A34 antibodies?

When selecting SLC25A34 antibodies for research applications, evaluate these critical quality control parameters:

• Validation methods documented: Review how the manufacturer validated specificity (Western Blot, knockout validation, peptide competition)

• Immunogen information: Assess whether the immunogen sequence is disclosed and its homology across species of interest

• Lot-to-lot consistency: Request data on lot-to-lot variability testing

• Application-specific validation: Ensure the antibody is validated for your specific application (WB, ICC, IP)

• Species reactivity: Verify cross-reactivity with your species of interest through sequence homology analysis

• Publication record: Check if the antibody has been cited in peer-reviewed publications

• Positive control recommendations: Confirm availability of recommended positive controls (e.g., HepG2 cells for SLC25A34)

• Storage and handling stability: Review stability data and storage recommendations

Many manufacturers provide detailed information about the validation methods used, including testing on protein arrays containing the target plus hundreds of non-specific proteins to ensure specificity .

How can inconsistent results with SLC25A34 antibodies across different applications be reconciled?

When facing inconsistent results across different applications using SLC25A34 antibodies, consider these reconciliation strategies:

• Application-specific optimization:

  • Adjust antibody concentrations based on application (typical WB dilutions: 1:500-1:3000; ICC: 1-4 μg/ml)

  • Modify fixation methods for ICC/IF applications (paraformaldehyde vs. methanol)

  • Optimize antigen retrieval for IHC applications

• Epitope accessibility assessment:

  • Different applications expose different epitopes

  • If an antibody works in Western Blot but not ICC, the epitope may be masked in native conformation

• Detection system evaluation:

  • Test alternative secondary antibodies or detection methods

  • Compare direct vs. amplified detection systems

• Sample preparation reconciliation:

  • For mitochondrial proteins like SLC25A34, enrichment may be necessary for some applications but not others

  • Consider native vs. denatured protein states across applications

• Antibody binding conditions optimization:

  • Adjust temperature (4°C vs. room temperature)

  • Modify incubation time (overnight vs. 1-2 hours)

  • Test different buffer compositions

• Multiple antibody validation:

  • Use antibodies targeting different epitopes of SLC25A34

  • Confirm results with at least two independent antibodies

This systematic approach can help determine whether inconsistencies reflect technical issues or biologically relevant differences in protein accessibility or modification across experimental conditions.

How might SLC25A34 antibodies contribute to understanding mitochondrial dysfunction in disease?

SLC25A34 antibodies can serve as valuable tools for investigating mitochondrial dysfunction across various disease contexts:

• Neurodegenerative diseases: Examine alterations in SLC25A34 expression or localization in models of Parkinson's, Alzheimer's, or ALS, where mitochondrial dysfunction is implicated.

• Metabolic disorders: Investigate the potential role of SLC25A34 in diabetes, obesity, or metabolic syndrome by analyzing its expression patterns in affected tissues.

• Cancer metabolism: Explore how SLC25A34 expression correlates with metabolic reprogramming in cancer cells, building on emerging evidence linking SLC25 family members to cancer progression and prognosis .

• Aging research: Assess age-related changes in SLC25A34 expression or post-translational modifications as potential contributors to mitochondrial decline during aging.

• Mitochondrial disease diagnostics: Evaluate SLC25A34 as a potential biomarker for specific mitochondrial disorders through analysis of patient samples.

• Drug-induced mitochondrial toxicity: Monitor changes in SLC25A34 as a potential indicator of mitochondrial stress in response to therapeutic compounds with known mitochondrial effects.

The relationship between SLC25A34 expression and outcomes in certain cancers suggests potential broader implications for understanding how mitochondrial transport proteins contribute to disease pathogenesis.

What are the considerations for implementing SLC25A34 antibodies in high-throughput screening approaches?

Implementing SLC25A34 antibodies in high-throughput screening requires careful consideration of several factors:

• Assay format selection:

  • ELISA-based screening offers quantitative results but requires careful antibody pair selection

  • Cell-based imaging requires optimization of fixation, permeabilization, and antibody concentration

• Antibody stability assessment:

  • Evaluate lot-to-lot consistency before large-scale screening

  • Determine antibody stability under automated handling conditions

• Signal detection optimization:

  • Select appropriate secondary antibodies or direct labeling strategies

  • Establish signal-to-noise ratios across the dynamic range of detection

• Control implementation:

  • Include positive controls (HepG2 cells) and negative controls (knockout or knockdown samples)

  • Implement plate-to-plate normalization controls

• Miniaturization considerations:

  • Optimize antibody concentrations for reduced volumes

  • Validate detection sensitivity in miniaturized format

• Automation compatibility:

  • Test antibody performance using automated liquid handling

  • Evaluate stability under typical screening storage conditions

• Data analysis parameters:

  • Establish robust normalization methods

  • Define appropriate statistical thresholds for hit identification

By addressing these considerations, researchers can effectively implement SLC25A34 antibodies in high-throughput screening campaigns to identify modulators of mitochondrial function or compounds that affect SLC25A34 expression or localization.

How can SLC25A34 antibodies be utilized in developing novel research tools for mitochondrial biology?

SLC25A34 antibodies can serve as foundations for developing innovative research tools in mitochondrial biology:

• Proximity labeling applications:

  • Conjugate SLC25A34 antibodies to enzymes like APEX2 or BioID to identify proximal proteins in the mitochondrial environment

  • Develop antibody-based FRET sensors to monitor SLC25A34 conformational changes in response to metabolic alterations

• Live-cell imaging tools:

  • Generate cell-permeable mini-antibodies or nanobodies against SLC25A34 for live imaging of mitochondrial dynamics

  • Develop antibody-based biosensors that detect SLC25A34 in specific mitochondrial microenvironments

• Targeted mitochondrial delivery systems:

  • Utilize SLC25A34 antibodies to direct therapeutic cargo specifically to mitochondria

  • Create mitochondrial-targeted immunotoxins for research models requiring selective mitochondrial ablation

• Mitochondrial isolation and purification:

  • Develop antibody-based magnetic separation techniques for isolating SLC25A34-containing mitochondrial subpopulations

  • Create affinity purification systems for SLC25A34-associated protein complexes

• Single-molecule analysis tools:

  • Implement antibody-based single-molecule tracking of SLC25A34 to understand its dynamics within the inner mitochondrial membrane

  • Develop super-resolution imaging probes based on SLC25A34 antibody fragments

• Functional screening platforms:

  • Create reporter systems where SLC25A34 antibodies are linked to proximity-dependent signaling cascades

  • Develop split-protein complementation assays incorporating SLC25A34 antibody fragments

These innovative applications extend beyond traditional antibody uses, leveraging the specificity of SLC25A34 antibodies to create next-generation tools for mitochondrial research.

What are the emerging trends in SLC25A34 antibody applications across different research fields?

SLC25A34 antibody applications are evolving across multiple research domains:

• Cancer biology: Increasing focus on using SLC25A34 antibodies to investigate connections between mitochondrial transport and cancer metabolism, building on findings relating SLC25 family members to cancer progression and treatment responses .

• Systems biology: Growing integration of SLC25A34 antibodies in multi-omics approaches that combine antibody-based detection with transcriptomics, metabolomics, and proteomics to create comprehensive views of mitochondrial function.

• Structural biology: Emerging use of antibodies as tools for stabilizing SLC25A34 for structural studies using cryo-EM or crystallography to understand transporter conformational states.

• Developmental biology: Expanding applications in tracking SLC25A34 expression during cellular differentiation and development to understand tissue-specific mitochondrial specialization.

• Precision medicine: Early exploration of SLC25A34 as a potential biomarker in personalized medicine approaches, particularly in cancer contexts where expression may correlate with treatment outcomes .

As research continues to uncover the specific functions of SLC25A34, antibody applications will likely expand to address more specialized questions about its role in mitochondrial biology and disease.

What future developments might enhance the utility of SLC25A34 antibodies in research?

Several technological and methodological advances could significantly enhance SLC25A34 antibody utility:

• Higher specificity monoclonal antibodies: Development of monoclonal antibodies with enhanced specificity for SLC25A34 over other SLC25 family members would improve research reliability.

• Conformation-specific antibodies: Creation of antibodies that recognize specific conformational states of SLC25A34 could provide insights into its transport mechanism and regulation.

• Post-translational modification-specific antibodies: Development of antibodies recognizing specific phosphorylation, acetylation, or other modifications of SLC25A34 would enable research into its regulation.

• Humanized antibodies for therapeutic exploration: Creation of humanized anti-SLC25A34 antibodies could facilitate investigation of potential therapeutic applications if SLC25A34 proves to be a viable drug target.

• Engineered antibody fragments: Development of smaller antibody fragments (Fabs, scFvs, nanobodies) against SLC25A34 would enable better penetration in tissue samples and potential in vivo applications.

• Multiplexed detection systems: Creation of antibody panels allowing simultaneous detection of SLC25A34 alongside other mitochondrial proteins would enhance co-expression studies.

• Improved validation standards: Establishment of rigorous validation criteria specifically for mitochondrial carrier protein antibodies would increase research reproducibility.