SLC43A1 Antibody

Introduction

SLC43A1, also known as LAT3 (L-type amino acid transporter 3), is a sodium-independent transporter of large neutral amino acids, including branched-chain amino acids (BCAAs) and phenylalanine . Its overexpression in prostate cancer and role in mTORC1 signaling has made it a critical target for cancer research . SLC43A1 antibodies are essential tools for studying its localization, expression, and functional mechanisms in both physiological and pathological contexts. This article provides a comprehensive overview of SLC43A1 antibodies, including their types, applications, validation methods, and clinical relevance, based on diverse scientific sources.

Polyclonal Antibodies

• Sigma-Aldrich HPA018826: Targets the internal region (NCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCS) and is validated for IHC (1:50–1:200) and IF (0.25–2 μg/mL) .

• Proteintech 10444-1-AP: Detects SLC43A1 in WB (1:500–1:1000) and IHC (1:50–1:500), with positive results in PC-3 (prostate cancer) and K562 cells .

Monoclonal Antibodies

• Proteintech 60667-4-PBS: A conjugation-ready antibody pair for multiplex assays, validated in cytometric bead arrays .

Applications and Techniques

SLC43A1 antibodies are employed in:

Validation Methods

Antibody specificity is ensured through:

• Protein Array Testing: 364 human recombinant protein fragments (Sigma-Aldrich, Proteintech) .

• Blocking Peptide Assays: Alomone’s ANT-193 (extracellular region) shows reduced signal with preincubation (e.g., K562 cells) .

• Orthogonal RNAseq: Confirms tissue expression patterns (Human Protein Atlas) .

Prognostic Biomarker

High SLC43A1 expression correlates with poor prognosis in prostate cancer, as shown by immunostaining of prostatectomy specimens (hazard ratio: 3.24, P = .0018) .

Therapeutic Target

Inhibitors like ESK246 (a monoterpene glycoside) block SLC43A1-mediated leucine uptake, suppressing mTORC1 signaling and cancer growth .

Future Directions

• Multiplex Assays: Monoclonal antibodies enable simultaneous detection of SLC43A1 with other transporters (e.g., LAT1) .

• Podocyte Research: Antibodies targeting the apical membrane domain may advance kidney disease diagnostics .