SLCO2A1 Antibody

What is SLCO2A1 protein and what are its primary functions?

SLCO2A1 (Solute carrier organic anion transporter family member 2A1) is a 70 kilodalton transmembrane protein primarily known as a prostaglandin transporter (PGT). The protein is also referred to by several other names including MATR1, OATP2A1, PHOAR2, and SLC21A2 .

This protein plays multiple critical physiological roles:

• Mediates the release of newly synthesized prostaglandins from cells

• Facilitates transepithelial transport of prostaglandins

• Contributes to the clearance of prostaglandins from circulation

• Transports multiple prostaglandin types including PGD2, PGE1, PGE2, and PGF2A

Recent research has identified SLCO2A1 as an essential core component of the ATP-conductive maxi-anion channel (Maxi-Cl), extending its functional significance beyond prostaglandin metabolism to ATP release pathways .

What applications are most commonly used for SLCO2A1 antibodies in research?

SLCO2A1 antibodies have been validated for multiple experimental applications:

When selecting an application, researchers should consider that different antibodies show varying reactivity across species, with most products validated for human samples, while some also react with mouse and rat orthologs .

How can researchers confirm the specificity of SLCO2A1 antibodies?

Confirming antibody specificity is crucial for reliable experimental results. Several validation approaches are recommended:

• Genetic validation: Using CRISPR/Cas9-mediated knockout or siRNA knockdown systems targeting SLCO2A1 gene expression to verify antibody specificity

• Protein array screening: Some commercial antibodies are validated against protein arrays containing the target protein plus hundreds of non-specific proteins to ensure selective binding

• Orthogonal validation: Comparing protein detection results with RNA-sequencing data to confirm correlation between transcript and protein levels

• Functional complementation: Testing antibody specificity by overexpressing microRNA-insensitive variants of SLCO2A1 in knockdown systems and confirming restored detection

Multiple studies have employed combinations of these approaches to validate antibody specificity, particularly in research examining SLCO2A1's role in ATP release mechanisms .

How can SLCO2A1 immunohistochemistry be used to differentiate between chronic enteropathy associated with SLCO2A1 (CEAS) and other inflammatory bowel diseases?

Immunohistochemical staining of SLCO2A1 protein has emerged as a valuable diagnostic tool for distinguishing CEAS from other inflammatory bowel diseases. The methodology follows this general protocol:

• Sample preparation: Use resected intestinal specimens fixed in formalin and embedded in paraffin.

• Staining procedure: Perform immunohistochemical staining using polyclonal anti-SLCO2A1 antibodies with appropriate dilution (typically 1:50-1:200).

• Evaluation metrics:

  • Extent score: Count positively-staining vascular endothelial cells and score as 0 (no cells), 1 (1%-30% cells), 2 (31%-60%), or 3 (>60%)

  • Intensity score: Rate the staining intensity as 0 (negative), 1 (intermediate), or 2 (strong)

  • Final score: Sum the extent and intensity scores (range: 0-5)

Research findings demonstrate significant differences in SLCO2A1 expression patterns:

• CEAS cases: Only 33% positive expression with mean final score of 1.6 (range 0-5)

• Crohn's disease: 100% positive expression with mean final score of 4.8 (range 4-5)

• Behçet's disease/simple ulcer: 100% positive expression with mean final score of 4.3 (range 4-5)

These distinctive staining patterns make immunohistochemistry a useful adjunct to genetic testing for CEAS diagnosis .

What is the relationship between SLCO2A1 and Maxi-Cl channels in ATP release mechanisms?

Recent research has identified SLCO2A1 as the core molecular component of the maxi-anion channel (Maxi-Cl), which functions as a major pathway for ATP release under various physiological and pathological conditions. The evidence supporting this relationship comes from multiple experimental approaches:

• Proteomics identification: LC-MS/MS analysis of proteins isolated from bleb membranes rich in Maxi-Cl activity identified SLCO2A1 as a key component .

• Genetic manipulation:

  • siRNA knockdown: Four different sequences targeting four different sites of Slco2a1 consistently suppressed Maxi-Cl activity

  • CRISPR/Cas9 knockout: Elimination of SLCO2A1 expression abolished Maxi-Cl channel activity

  • Heterologous expression: SLCO2A1 expression in cells lacking endogenous expression restored Maxi-Cl activity

• Functional reconstitution: Recombinant SLCO2A1 exhibited Maxi-Cl activity when incorporated into proteoliposomes, confirming its direct involvement in channel formation .

• Mutation analysis: Disease-causing mutants of SLCO2A1 failed to activate Maxi-Cl currents, while charge-neutralized mutants altered channel selectivity and conductance, demonstrating structure-function relationships .

The physiological significance of this SLCO2A1-Maxi-Cl relationship has been demonstrated in:

• ATP release from swollen C127 cells under hypoosmotic stress

• ATP release from Langendorff-perfused mouse hearts subjected to ischemia-reperfusion injury

This dual function of SLCO2A1 as both a prostaglandin transporter and ATP-release channel suggests broader physiological roles than previously recognized.

How do mutations in the SLCO2A1 gene affect protein expression and clinical phenotypes?

Mutations in the SLCO2A1 gene have been linked to two distinct clinical entities:

• Chronic enteropathy associated with SLCO2A1 (CEAS)

• Primary hypertrophic osteoarthropathy (PHO)/pachydermoperiostosis (PDP)

Research has identified multiple mutation patterns with varying effects on protein expression:

Clinical and laboratory correlations with mutation status have revealed:

• Biochemical markers: Higher urinary levels of prostaglandin E metabolites (t-PGEM) correlate with disease severity in CEAS patients, suggesting functional impairment of prostaglandin transport .

• Phenotypic spectrum: Some patients exhibit features of both CEAS and PHO/PDP, though most CEAS patients lack the characteristic dermatological findings of PHO/PDP .

• Familial patterns: Novel mutations continue to be identified in sibling cases, expanding our understanding of genotype-phenotype correlations .

Methodological approaches to studying these relationships include:

• Genetic screening through whole-exome sequencing

• Immunohistochemical staining of patient tissues

• Measurement of urinary prostaglandin metabolites

• Clinical correlation with laboratory parameters (anemia, hypoproteinemia)

What methodological considerations are important when using SLCO2A1 antibodies for immunohistochemistry?

Successfully employing SLCO2A1 antibodies for immunohistochemistry requires attention to several critical methodological factors:

• Antigen retrieval: Heat-induced epitope retrieval (HIER) at pH 6.0 is recommended for optimal staining with most SLCO2A1 antibodies .

• Antibody selection:

  • Polyclonal antibodies targeting the N-terminal region (amino acids 611-643/643) have shown good specificity in multiple studies

  • Consider using antibodies developed against recombinant proteins corresponding to the sequence: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH

• Tissue-specific considerations:

  • Vascular endothelial cells serve as internal positive controls in most tissues

  • Strong membranous positivity should be evident in specific cell types:

    • Endothelial cells in prostate tissue

    • Glandular cells in seminal vesicle

• Scoring systems: Implementing standardized scoring methods is essential for reproducible results:

  • Extent scoring (percentage of positive cells)

  • Intensity scoring (strength of staining)

  • Combined scoring approaches

• Assay validation:

  • Include positive and negative controls in each staining run

  • Consider dual staining with endothelial markers to confirm vascular expression patterns

  • Compare results with genetic analysis when available

These considerations help ensure reliable and reproducible immunohistochemical detection of SLCO2A1 across different tissue types and disease states.

How might the dual function of SLCO2A1 as both prostaglandin transporter and ATP release channel be leveraged in cardiovascular research?

The discovery that SLCO2A1 functions not only as a prostaglandin transporter but also as a core component of ATP-releasing Maxi-Cl channels opens new research directions in cardiovascular medicine:

• Protective mechanisms in ischemia-reperfusion: Released ATP plays a protective role in ischemia-reperfusion heart injury, as demonstrated in Langendorff-perfused mouse heart models. SLCO2A1's involvement in this ATP release pathway suggests it may be a therapeutic target for myocardial protection .

• Experimental approaches:

  • In vitro models: Slco2a1 silencing in cell culture systems to study ATP release mechanisms

  • Ex vivo models: Langendorff-perfused hearts from wild-type and SLCO2A1-deficient mice

  • In vivo approaches: Targeted SLCO2A1 modulation in animal models of cardiac ischemia

• Therapeutic implications:

  • Development of SLCO2A1 activators may represent a novel strategy for preventing damage from myocardial infarction

  • The wide tissue distribution of SLCO2A1 (brain, heart, lung, liver, gastrointestinal tract, kidney, and eye) suggests potential applications beyond cardiovascular disease

• Methodological considerations:

  • Measurement of ATP release using luminometric assays

  • Assessment of cardiac function parameters following ischemia-reperfusion

  • Pharmacological modulation of SLCO2A1 activity to evaluate cardioprotective effects

This dual functionality positions SLCO2A1 as a potential target for drug discovery efforts aimed at conditions involving both prostaglandin dysregulation and ATP-dependent signaling mechanisms .

What are the implications of SLCO2A1 mutations for rare disease research and diagnosis?

The identification of SLCO2A1 mutations in rare disorders like CEAS and PHO/PDP has important implications for diagnosis and research:

• Diagnostic algorithms: Combining genetic testing for SLCO2A1 mutations with immunohistochemical analysis provides a more comprehensive diagnostic approach:

  Diagnostic Approach	Advantages	Limitations
  Genetic sequencing	Definitive diagnosis, identifies novel variants	Expensive, time-consuming, may miss large deletions
  Immunohistochemistry	Faster, less expensive, provides functional information	May not detect all mutation types, requires tissue samples
  Combined approach	Highest diagnostic accuracy	Most resource-intensive

• Genotype-phenotype correlations: Different SLCO2A1 mutation patterns appear to correlate with disease severity and presentation:

  • Homozygous splice mutations typically result in negative protein expression and more severe phenotypes

  • Compound heterozygous mutations may allow some protein expression but with impaired function

• Disease mechanism insights: Studying how different mutations affect protein localization, stability, and function helps elucidate the molecular pathophysiology of CEAS and related disorders

• Biomarker development: Urinary prostaglandin metabolites (especially t-PGEM) appear to correlate with disease severity in patients with SLCO2A1 mutations, suggesting potential as biomarkers for disease monitoring

Future research directions include development of mutation-specific therapeutic approaches and expanded screening for SLCO2A1 mutations in patients with undiagnosed chronic enteropathies.

How can SLCO2A1 antibodies be used to study the relationship between prostaglandin transport and ATP release pathways?

The dual functionality of SLCO2A1 creates opportunities for studying the potential interrelationship between prostaglandin transport and ATP release:

• Co-localization studies: Using fluorescently labeled SLCO2A1 antibodies alongside markers for ATP release sites or prostaglandin synthesis enzymes to determine spatial relationships within cells and tissues.

• Functional coupling analysis: Investigating whether prostaglandin transport and ATP release are functionally coupled or independently regulated by:

  • Monitoring both processes simultaneously in cell models

  • Testing whether pharmacological inhibition of one function affects the other

  • Examining how disease-causing mutations differentially impact each function

• Structure-function relationships: Using site-directed mutagenesis to identify:

  • Domains critical for prostaglandin transport

  • Domains essential for Maxi-Cl channel formation and ATP conductance

  • Regions involved in regulatory interactions

• Methodological approaches:

  • Reconstitution of purified SLCO2A1 in proteoliposomes to study transport properties in isolation

  • Patch-clamp electrophysiology combined with prostaglandin transport assays

  • Advanced imaging techniques to visualize transport dynamics in real-time

Understanding these relationships may reveal novel regulatory mechanisms and potential therapeutic targets for conditions involving dysregulation of either pathway.