SMARCAL1 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to SMARCAL1 Antibody

SMARCAL1 antibodies are immunological reagents specifically designed to recognize and bind the SMARCAL1 protein (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A-Like 1), also known as HARP (HepA-related protein) or HHARP. These antibodies serve as essential research tools for detecting, visualizing, and analyzing SMARCAL1 expression, localization, and interactions within cellular contexts .

SMARCAL1 belongs to the SWI/SNF family of helicase and ATPase proteins, which are pivotal in chromatin remodeling processes. The protein is predominantly localized in the nucleus, where it performs critical ATP-dependent nucleosome-remodeling activities that facilitate DNA accessibility for transcription and repair processes. With a molecular weight of approximately 105-106 kDa, SMARCAL1 protein consists of 954 amino acids and includes one conserved C-terminal SNF2 domain, one helicase ATP-binding domain, and two HARP domains .

Commercial SMARCAL1 antibodies are produced through immunization procedures using synthetic peptides or recombinant protein fragments corresponding to specific regions of the human SMARCAL1 protein. These antibodies are available in various forms, including monoclonal and polyclonal variants, each offering distinct advantages for different research applications.

Types and Formulations

SMARCAL1 antibodies are available in several formulations that determine their application versatility:

Antibody TypeHost SpeciesClonalityCommon FormatCompanies
Anti-SMARCAL1MouseMonoclonal (E-12, A-2)UnconjugatedSanta Cruz Biotechnology
Anti-SMARCAL1RabbitMonoclonal (D3P5I)UnconjugatedCell Signaling Technology
Anti-SMARCAL1RabbitPolyclonalUnconjugatedProteintech, Sigma-Aldrich, Abcam
Anti-SMARCAL1RabbitPolyclonalHRP-conjugatedCUSABIO
Anti-SMARCAL1RabbitPolyclonalFITC-conjugatedCUSABIO
Anti-SMARCAL1RabbitPolyclonalBiotin-conjugatedCUSABIO

Most commercially available antibodies are provided in liquid form, often buffered in solutions containing stabilizers such as sodium azide and glycerol to maintain reactivity during storage .

Immunogen Characteristics

The specificity and performance of SMARCAL1 antibodies largely depend on the immunogen used in their production:

  1. Cell Signaling Technology's D3P5I antibody is produced by immunizing animals with a synthetic peptide corresponding to residues surrounding Ala933 of human SMARCAL1 protein .

  2. Sigma-Aldrich's antibody (HPA020337) utilizes an immunogen sequence covering a specific region of the SMARCAL1 protein: "SYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKGKCVRNGDRFQVLIGYNAELIAVFKTLPSKNYDPDTKTWNFS" .

  3. Proteintech's antibody (12513-1-AP) is generated against a SMARCAL1 fusion protein designated Ag3194 .

  4. Abcam's rabbit polyclonal antibody (ab154226) targets a recombinant fragment within human SMARCAL1 amino acids 100-500 .

Applications and Methodological Considerations

SMARCAL1 antibodies demonstrate utility across multiple experimental techniques, allowing researchers to investigate this protein from different perspectives.

Common Research Applications

The primary applications of SMARCAL1 antibodies include:

ApplicationRecommended Dilution RangeNotable Products
Western Blotting (WB)1:500-1:5000Most commercial antibodies
Immunoprecipitation (IP)1:50Cell Signaling Technology #44717, Abcam ab154226
Immunofluorescence (IF)1:50-1:200Santa Cruz sc-166209, Sigma-Aldrich HPA020337
Enzyme-Linked Immunosorbent Assay (ELISA)Varies by productCUSABIO antibodies
Immunohistochemistry (IHC)1:200-1:500Sigma-Aldrich HPA020337, Proteintech 12513-1-AP

When performing Western blotting, SMARCAL1 is typically detected at approximately 105-106 kDa, which corresponds to its predicted molecular weight. For optimal results, researchers must carefully titrate antibody concentrations based on the specific sample type and experimental conditions .

Species Cross-Reactivity

Most commercially available SMARCAL1 antibodies are designed to detect human SMARCAL1, though some may cross-react with other species due to sequence homology. Researchers should verify species reactivity before experimental use, especially when working with non-human models .

Sample Preparation Considerations

For successful detection of SMARCAL1, proper sample preparation is essential:

  1. For Western blotting, samples are typically separated on 4-12% or 5% SDS-PAGE gels.

  2. For immunofluorescence, fixation methods may affect epitope accessibility.

  3. For immunohistochemistry, antigen retrieval techniques may be necessary to expose the target epitope.

SMARCAL1 Structure and Cellular Functions

Understanding the structure and function of SMARCAL1 is crucial for interpreting antibody-based experimental results and developing targeted research strategies.

Molecular Structure and Domains

SMARCAL1 is characterized by several functional domains that contribute to its biological activities:

  1. One conserved C-terminal SNF2 domain

  2. One helicase ATP-binding domain

  3. Two HARP (HepA-related protein) domains

These structural elements enable SMARCAL1 to function as an ATP-dependent annealing helicase that selectively binds fork DNA relative to single-stranded DNA (ssDNA) or double-stranded DNA (dsDNA) .

Cellular Functions

SMARCAL1 performs several critical functions within the cellular environment:

  1. DNA Damage Response: SMARCAL1 is phosphorylated by DNA repair kinases (ATM, ATR, DNA-PK) during replication stress, participating in the stabilization and repair of stalled replication forks .

  2. Chromatin Remodeling: As part of the SWI/SNF family, SMARCAL1 facilitates ATP-dependent nucleosome remodeling, making DNA more accessible for transcription and repair processes .

  3. DNA Rewinding: SMARCAL1 catalyzes the rewinding of stably unwound DNA, essentially performing the opposite reaction of helicases and polymerases that unwind DNA .

  4. Replication Fork Stability: SMARCAL1 deficiency sensitizes cells to replication stress agents and increases the frequency of replication fork breakdown .

  5. Double-Strand Break Repair: SMARCAL1 contributes to efficient DNA double-strand break repair via the nonhomologous end joining (NHEJ) pathway .

SMARCAL1 in Disease Pathology

The clinical significance of SMARCAL1 has been established through genetic studies and expression analyses in various pathological conditions.

Genetic Disorders

Mutations in the SMARCAL1 gene cause Schimke immuno-osseous dysplasia (SIOD), an autosomal recessive disorder characterized by multiple phenotypic manifestations:

  1. Spondyloepiphyseal dysplasia

  2. Renal dysfunction

  3. T cell immunodeficiency

  4. Impaired neurological function

The diverse phenotypes associated with SIOD reflect SMARCAL1's multifunctional role in maintaining cellular homeostasis and proper immune function .

Cancer Associations

Recent research has revealed significant connections between SMARCAL1 expression and cancer development:

  1. SMARCAL1 is overexpressed in several cancer types, including Glioma, Lung Adenocarcinoma (LUAD), Kidney Renal Clear Cell Carcinoma (KIRC), and Liver Hepatocellular Carcinoma (LIHC) .

  2. Elevated SMARCAL1 expression correlates with poor outcomes in Glioma, LUAD, and LIHC, though interestingly, it associates with better survival in KIRC, suggesting context-dependent effects .

  3. SMARCAL1 deficiency has been linked to predisposition to non-Hodgkin's lymphoma, highlighting its role in maintaining genomic stability .

Recent Research Findings

Recent studies utilizing SMARCAL1 antibodies have yielded significant insights into the protein's roles in cellular processes and disease mechanisms.

SMARCAL1 as a Dual Regulator in Cancer

A groundbreaking 2024 study identified SMARCAL1 as a dual regulator that favors tumor immune evasion through two distinct mechanisms:

  1. Suppression of Innate Immune Signaling: SMARCAL1 limits endogenous DNA damage, thereby suppressing cGAS-STING-dependent signaling during cancer cell growth .

  2. Induction of Immune Checkpoint Responses: SMARCAL1 cooperates with the AP-1 family member JUN to maintain chromatin accessibility at a PD-L1 transcriptional regulatory element, promoting PD-L1 expression in cancer cells .

These findings suggest that SMARCAL1 inhibition could enhance anti-tumor immune responses and sensitize tumors to immune checkpoint blockade therapy.

Pan-Cancer Analysis of SMARCAL1 Expression

A comprehensive pan-cancer analysis published in February 2025 evaluated SMARCAL1 expression across 33 cancer types using TCGA, GTEx, and CCLE databases. Key findings included:

  1. Significant associations between SMARCAL1 expression and DNA methylation in 13 cancer types.

  2. Correlation between SMARCAL1 expression and immune infiltration.

  3. Identification of SMARCAL1 as a potential therapeutic target in cancer immunotherapy .

Clinical Relevance in Immunotherapy

Analysis of SMARCAL1 expression in cancer patient datasets has revealed important clinical correlations:

  1. SMARCAL1 is overexpressed in most human tumors.

  2. Patients with low SMARCAL1 expression show downregulation of cell proliferation pathways and upregulation of inflammatory response pathways.

  3. Low SMARCAL1 expression correlates with reduced PD-L1 expression in 85% of tumor types.

  4. Patients responding to anti-PD-1 immunotherapy express lower levels of SMARCAL1 relative to non-responders .

These observations highlight the potential value of SMARCAL1 as a biomarker for predicting immunotherapy response and as a therapeutic target for enhancing anti-tumor immunity.

Future Directions and Potential Applications

The evolving understanding of SMARCAL1 biology suggests several promising directions for future research and applications.

Therapeutic Potential

Targeting SMARCAL1 holds promise for enhancing cancer treatment efficacy:

  1. SMARCAL1 inhibition could sensitize cancer cells to chemotherapeutic agents by compromising DNA repair mechanisms .

  2. Combined approaches targeting SMARCAL1 and immune checkpoint blockade may provide synergistic benefits in cancer immunotherapy .

  3. Development of small molecule inhibitors specifically targeting SMARCAL1's enzymatic activity could represent a novel therapeutic strategy.

Diagnostic Applications

SMARCAL1 antibodies may prove valuable in diagnostic and prognostic applications:

  1. Assessment of SMARCAL1 expression levels could help predict patient responses to immunotherapy.

  2. Monitoring SMARCAL1 phosphorylation status might serve as a biomarker for replication stress and genomic instability.

  3. Evaluation of SMARCAL1 expression patterns across tumor types may contribute to more precise cancer classification and treatment selection.

Technical Advancements

Future development of SMARCAL1 antibodies may focus on:

  1. Generating antibodies with enhanced specificity for different SMARCAL1 phosphorylation states.

  2. Creating antibodies targeting specific functional domains to investigate domain-specific functions.

  3. Developing nanobodies or intrabodies for real-time tracking of SMARCAL1 dynamics in living cells.

Product Specs

Buffer
PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. Store at -20°C. Avoid repeated freeze-thaw cycles.
Lead Time
Typically, we can ship your order within 1-3 business days after receiving it. Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Synonyms
HARP antibody; HepA Related Protein antibody; HepA-related protein antibody; hHARP antibody; SIOD antibody; SMAL1_HUMAN antibody; SMARCA like Protein 1 antibody; smarcal1 antibody; Sucrose nonfermenting protein 2 like 1 antibody; Sucrose nonfermenting protein 2-like 1 antibody; SWI/SNF Related antibody; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A like protein 1 antibody; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 antibody
Target Names
SMARCAL1
Uniprot No.

Target Background

Function
SMARCAL1 is an ATP-dependent annealing helicase. It exhibits selective binding to fork DNA compared to single-stranded (ssDNA) or double-stranded DNA (dsDNA). SMARCAL1 catalyzes the rewinding of stably unwound DNA. This enzyme effectively rewinds single-stranded DNA bubbles that are stably bound by replication protein A (RPA). SMARCAL1 plays a crucial role throughout the genome in reannealing stably unwound DNA. Unlike many other enzymes such as helicases and polymerases that unwind DNA, SMARCAL1 performs the opposite reaction. This activity suggests that SMARCAL1 might play a significant role in the DNA damage response by acting at stalled replication forks.
Gene References Into Functions
  • A large number of SNF2 family, DNA and ATP-dependent motor proteins are essential during transcription, DNA replication, and DNA repair. They manipulate protein-DNA interactions and alter DNA structure. SMARCAL1, ZRANB3, and HLTF are three related members of this family with specialized functions crucial for maintaining genome stability during DNA replication. PMID: 28954549
  • SMARCAL1 plays crucial roles in DNA repair, telomere maintenance, and replication fork stability in response to DNA replication stress. PMID: 28623093
  • Depletion of SMARCAL1, a SNF2-family DNA translocase that remodels stalled forks, restores replication fork stability and reduces the formation of replication stress-induced DNA breaks and chromosomal aberrations in BRCA1/2-deficient cells. Notably, other SNF2-family fork remodelers, including ZRANB3 and HLTF, can induce nascent DNA degradation and genomic instability. PMID: 29053959
  • Research indicates that SMARCAL1, a crucial component of the DNA replication stress response, plays a vital role in hematopoietic cell survival and tumor development. These findings provide insight into the immunodeficiency observed in individuals with SMARCAL1 mutations, suggesting a defect in hematopoietic stem and progenitor cells (HSPCs). PMID: 27797382
  • The mechanism by which SMARCAL1 maintains genome stability has been extensively studied. PMID: 27355316
  • Studies have shown that deficiency of a SMARCAL1 ortholog can alter the chromatin structure of a gene. PMID: 27813696
  • Evidence suggests that BRG1 and SMARCAL1 regulate each other. BRG1 binds to the SMARCAL1 promoter, while SMARCAL1 binds to the BRG1 promoter. During DNA damage, the occupancy of SMARCAL1 on the BRG1 promoter increases, coinciding with an increase in BRG1 occupancy on the SMARCAL1 promoter. This reciprocal regulation leads to increased BRG1 and SMARCAL1 transcript levels. PMID: 26843359
  • The replication stress response protein SMARCAL1 plays a critical regulatory role in alternative lengthening of telomeres (ALT) activity. PMID: 26832416
  • SMARCAL1 negatively regulates c-myc transcription by altering the conformation of its promoter region during differentiation. PMID: 26648259
  • Mutations in human SMARCAL1 that result in loss of ATPase activity lead to increased replication stress, potentially contributing to the manifestation of Schimke immuno-osseous dysplasia (SIOD). PMID: 26195148
  • Research has identified an endogenous source of replication stress that requires SMARCAL1 for resolution, highlighting differences between members of this class of replication fork-repair enzymes. PMID: 26578802
  • SMARCAL1 enhances nonhomologous end-joining repair. It is thought to achieve this by interacting with RPA at unwound single-strand sequences and then facilitating annealing at double-strand-break ends. PMID: 26089390
  • The role of SMARCAL1 in the pathogenesis of Schimke immuno-osseous dysplasia (SIOD) has been extensively studied. PMID: 25319549
  • Beyond its annealing helicase activity, which eliminates the natural binding substrate for RPA, HARP inhibits the phosphorylation of RPA by DNA-PK. PMID: 24565939
  • Studies have provided the first evidence of intrinsic chromosomal instability in a severe SMARCAL1-deficient patient with a clinical picture of SIOD. PMID: 24197801
  • Conserved motifs are essential for RPA32 binding to the N-terminus of SMARCAL1. PMID: 24910198
  • A report described the clinical and genetic characteristics of a mild phenotype of Schimke immuno-osseous dysplasia associated with nephrotic proteinuria, which improved after combined therapy with ACE inhibitors and sartans. PMID: 24589093
  • A study characterized the RPA32C-SMARCAL1 interface at the molecular level. These findings have implications for understanding the recruitment of SMARCAL1 and other DNA damage response and repair proteins to stalled replication forks. PMID: 24730652
  • Data suggests that replication protein A (RPA) brings a complex of SMARCAL1 and WRN to stalled forks, but they might act in different pathways to promote fork repair and restart. PMID: 23671665
  • Schimke Immunoosseous Dysplasia was reported in a child with undifferentiated carcinoma and a novel SMARCAL1 mutation. PMID: 23630135
  • ATR phosphorylates SMARCAL1 on S652, thereby limiting its fork regression activities and preventing aberrant fork processing. PMID: 23873943
  • A review summarizes advances in understanding the biochemical and cellular functions of SMARCAL1. It also discusses the rationale for developing SMARCAL1 inhibitors as potential novel anticancer therapies. PMID: 22995303
  • SMARCAL1 annealing helicase buffers fluctuations in gene expression, and alterations in gene expression contribute to the penetrance of SIOD. PMID: 22378147
  • SMARCAL1 continuously monitors replication forks for damage. PMID: 22279047
  • Loss of SMARCAL1 function in patients may cause DNA replication-associated genome instability, which contributes to the pleiotropic phenotypes of Schimke immuno-osseous dysplasia (SIOD). PMID: 21327070
  • The HARP domain provides SMARCAL1 with its ATP-driven annealing helicase activity. PMID: 21525954
  • Novel compound mutations of SMARCAL1 have been identified in a Chinese patient with severe Schimke immuno-osseous dysplasia. PMID: 20179009
  • A case study highlights a patient with severe early-onset Schimke immuno-osseous dysplasia who survived to 20 years despite having a homozygous SMARCAL1 nonsense mutation. PMID: 12471207
  • A missense mutation in the SMARCAL1 gene has been associated with mild Schimke immuno-osseous dysplasia. PMID: 16237566
  • SMARCAL1 is mutated in Schimke immuno-osseous dysplasia, a fatal autosomal recessive disorder. PMID: 16840568
  • The severity of Schimke immuno-osseous dysplasia (SIOD) within the same family can be influenced by the splicing machinery. The renal expression pattern of SMARCAL1 explains a broader spectrum of renal disease in SIOD than previously described. PMID: 18356746
  • SMARCAL1 deficiency may impact brain development and function, in addition to its known effects on cerebral circulation. PMID: 18520775
  • SMARCAL1 binds chromatin in vivo, and Schimke immuno-osseous dysplasia arises from impairment of diverse SMARCAL1 functions. PMID: 18805831
  • Research found that HARP is an ATP-dependent annealing helicase that rewinds single-stranded DNA bubbles stably bound by replication protein A. PMID: 18974355
  • SMARCAL1 mutations have been identified as a cause of prepubertal idiopathic steroid-resistant nephrotic syndrome. PMID: 19127206
  • Donor serum SMARCAL1 may serve as a specific, sensitive, and noninvasive predictive marker for assessing cardiac graft quality. PMID: 19752368
  • SMARCAL1 directly interacts with Replication protein A (RPA) and is recruited to sites of DNA damage in an RPA-dependent manner. PMID: 19793862
  • The interaction of HARP with RPA increases the concentration of annealing helicase activity near ssDNA regions, facilitating processes such as DNA repair. PMID: 19793863
  • ARP is recruited to stalled replication forks through its direct interaction with Replication protein A (RPA). PMID: 19793864
  • SMARCAL1 is a novel DNA damage-binding protein involved in replication fork stabilization. PMID: 19841479

Show More

Hide All

Database Links

HGNC: 11102

OMIM: 242900

KEGG: hsa:50485

STRING: 9606.ENSP00000349823

UniGene: Hs.516674

Involvement In Disease
Schimke immuno-osseous dysplasia (SIOD)
Protein Families
SNF2/RAD54 helicase family, SMARCAL1 subfamily
Subcellular Location
Nucleus. Note=Recruited to damaged DNA regions.
Tissue Specificity
Ubiquitously expressed, with high levels in testis.

Q&A

Basic Research Questions

  • What is SMARCAL1 and why is it significant in cancer research?

    SMARCAL1 is a SNF2-family DNA translocase involved in maintaining genome stability by facilitating DNA rearrangement and repair . Recent research has identified SMARCAL1 as a dual regulator in tumor immune evasion, making it especially significant in cancer research. It functions by both suppressing innate immune signaling (by limiting endogenous DNA damage that would trigger cGAS-STING-dependent signaling) and simultaneously inducing PD-L1-mediated immune checkpoint responses . This dual functionality makes SMARCAL1 a promising target for cancer immunotherapy, as its expression correlates with immune infiltration across multiple cancer types .

  • What are the preferred applications for SMARCAL1 antibodies in research?

    SMARCAL1 antibodies are valuable tools for:

    • Immunoblotting/Western blot analysis to detect SMARCAL1 protein levels in cellular extracts

    • Immunoprecipitation to study protein-protein interactions, such as its association with RPA

    • Immunofluorescence microscopy to visualize nuclear localization and co-localization with DNA damage response proteins like RPA32 and RAD51

    • Chromatin immunoprecipitation (ChIP) assays to investigate SMARCAL1's role in maintaining chromatin accessibility at regulatory elements, particularly for genes like PD-L1

    • Flow cytometry for analyzing SMARCAL1 expression levels in tumor samples

  • How does SMARCAL1 expression vary across different cancer types?

    Pan-cancer analysis has revealed significant variation in SMARCAL1 expression across cancer types:

    • Overexpression has been observed in several cancers, including Glioma, Lung Adenocarcinoma (LUAD), Kidney Renal Clear Cell Carcinoma (KIRC), and Liver Hepatocellular Carcinoma (LIHC)

    • The prognostic significance of SMARCAL1 expression differs by cancer type - elevated expression correlates with poor outcomes in Glioma, LUAD, and LIHC, but interestingly associates with better survival in KIRC

    • SMARCAL1 expression correlates with DNA methylation patterns in 13 different cancer types, suggesting epigenetic regulation plays a role in its expression

    • Expression levels also correlate with tumor mutational burden (TMB) in several cancers, including Glioma (R = 0.16), LUAD (R = 0.16), and KIRC (R = 0.11)

  • What controls should be included when using SMARCAL1 antibodies in immunodetection experiments?

    When designing experiments with SMARCAL1 antibodies, include the following controls:

    • Positive controls: Cell lines known to express SMARCAL1 (e.g., U2OS cells which have been used in SMARCAL1-GFP expression studies)

    • Negative controls: SMARCAL1 knockdown or knockout samples created using RNAi or CRISPR techniques

    • Isotype controls: Antibodies of the same isotype but irrelevant specificity to assess non-specific binding

    • Peptide competition assays: Pre-incubating the antibody with the immunizing peptide to confirm specificity

    • Cross-reactivity testing: When working with model organisms, verify the antibody's species reactivity (particularly important as studies have utilized both human and Xenopus SMARCAL1)

Advanced Research Questions

  • How does SMARCAL1 mechanistically influence immune infiltration in tumors?

    SMARCAL1 affects immune infiltration through multiple mechanisms:

    • It demonstrates significant correlations with CD4 T cell, CD8 T cell, and T helper cell infiltration across multiple cancer types

    • Cancer-specific patterns show that SMARCAL1 expression positively correlates with:

      • Type 2 T helper cells (R = 0.28) and Activated CD4 T cells (R = 0.26) in Glioma

      • Type 2 T helper cells (R = 0.24) in LIHC

      • Memory B cells (R = 0.33) and Regulatory T cells (R = 0.29) in KIRC

      • Type 2 T helper cells (R = 0.29) in UCEC

    • Negative correlations exist with:

      • Eosinophils (R = -0.24) and Mast cells (R = -0.14) in LUAD

      • Neutrophils (R = -0.34) in LIHC

      • Eosinophils (R = -0.31) in UCEC

    • SMARCAL1 suppresses cGAS-STING-dependent signaling by limiting endogenous DNA damage, which otherwise would trigger innate immune responses

    • Additionally, it regulates PD-L1 expression, a key immune checkpoint protein that inhibits T cell function in the tumor microenvironment

  • What experimental approaches can resolve contradictions in SMARCAL1 function across different cell types?

    To address contradictory findings regarding SMARCAL1 function across cell types:

    • Perform parallel knockdown/knockout studies in multiple cell lines representing different tissue origins

    • Utilize rescue experiments with wildtype versus mutant SMARCAL1 to identify domain-specific functions

    • Conduct comparative ChIP-seq across cell types to map differential genomic binding sites

    • Implement RNA-seq following SMARCAL1 depletion to identify cell-type specific transcriptional responses

    • Apply proteomics approaches (IP-MS) to characterize cell-type specific SMARCAL1 interaction partners

    • Develop inducible expression systems to study acute versus chronic effects of SMARCAL1 modulation

    • Examine post-translational modifications that might alter SMARCAL1 function in a context-dependent manner

    • Use single-cell approaches to address heterogeneity within populations that might explain contradictory findings

  • What are the optimal approaches for studying SMARCAL1's dual functions in the cGAS-STING pathway and PD-L1 regulation?

    To effectively study SMARCAL1's dual regulatory roles:

    • For cGAS-STING pathway suppression:

      • Monitor cytosolic DNA levels using DNA-specific dyes or anti-DNA antibodies in SMARCAL1-depleted versus control cells

      • Quantify cGAS-bound DNA using ChIP or proximity ligation assays

      • Measure STING activation by assessing its dimerization, phosphorylation, and translocation

      • Analyze downstream signaling through TBK1 and IRF3 phosphorylation

      • Quantify type I interferon production and ISG (Interferon Stimulated Gene) expression

    • For PD-L1 regulation:

      • Perform ChIP-seq for SMARCAL1 and JUN at the PD-L1 locus

      • Use ATAC-seq to assess chromatin accessibility changes at PD-L1 regulatory elements upon SMARCAL1 manipulation

      • Implement CUT&RUN or CUT&Tag for high-resolution mapping of SMARCAL1 binding sites

      • Analyze histone modifications at the PD-L1 locus in response to SMARCAL1 depletion

      • Conduct reporter assays with wildtype and mutant PD-L1 regulatory elements

      • Use 3C/4C/Hi-C techniques to assess long-range chromatin interactions impacted by SMARCAL1

    • For integrated studies:

      • Create separation-of-function SMARCAL1 mutants that specifically disrupt either DNA damage suppression or transcriptional regulation

      • Use single-cell multi-omics to correlate DNA damage, immune signaling, and PD-L1 expression in individual cells

      • Develop inducible systems to temporally separate SMARCAL1's effects on DNA damage and gene regulation

  • What technical challenges exist when using SMARCAL1 antibodies for chromatin immunoprecipitation (ChIP) assays?

    ChIP assays with SMARCAL1 antibodies present several technical challenges:

    • Epitope accessibility issues: SMARCAL1's interaction with chromatin may obscure antibody epitopes

    • Cross-linking effects: Standard formaldehyde cross-linking might interfere with antibody recognition of SMARCAL1

    • Transient interactions: SMARCAL1's dynamic association with chromatin may result in low signal-to-noise ratios

    • Specificity concerns: SMARCAL1 belongs to the SNF2 family, which has multiple members with similar domains

    • Wash conditions: Optimizing salt and detergent concentrations is crucial to maintain specific interactions while reducing background

    Methodological solutions include:

    • Testing multiple antibodies targeting different SMARCAL1 epitopes

    • Comparing native ChIP versus cross-linked ChIP approaches

    • Implementing epitope-tagged versions of SMARCAL1 for ChIP using tag-specific antibodies

    • Using dual cross-linking strategies (formaldehyde + DSG/EGS) to capture transient interactions

    • Adapting specialized ChIP protocols for factors involved in DNA replication and repair

    • Incorporating spike-in controls to normalize for technical variation

    • Validating ChIP-seq findings with orthogonal methods such as CUT&RUN or CUT&Tag

  • How can researchers effectively study the interaction between SMARCAL1 and RPA using antibody-based approaches?

    The SMARCAL1-RPA interaction is critical for SMARCAL1 function and can be studied using:

    • Co-immunoprecipitation (Co-IP): Immunoprecipitate SMARCAL1 and blot for RPA subunits (particularly RPA70 and RPA32) or vice versa

    • Proximity ligation assay (PLA): Visualize and quantify SMARCAL1-RPA interactions in situ with high sensitivity

    • FRET or BiFC: Monitor direct protein-protein interactions in living cells using fluorescently tagged proteins

    • Domain mapping: Create truncated constructs of SMARCAL1, particularly focusing on the N-terminal region which contains the RPA-binding motif

    • Peptide competition assays: Use synthetic peptides corresponding to the N-terminal SMARCAL1 RPA-binding motif to disrupt interactions

    • Immunofluorescence co-localization: Analyze spatial overlap between SMARCAL1 and RPA at sites of DNA damage or stalled replication forks

    • ChIP-reChIP: Determine if SMARCAL1 and RPA bind simultaneously to the same DNA fragments

    • Assessing post-translational modifications: Investigate how phosphorylation of either protein affects their interaction

    Control experiments should include:

    • DNase treatment to distinguish direct protein interactions from DNA-mediated associations

    • RPA binding-deficient SMARCAL1 mutants as negative controls

    • Cell cycle synchronization to assess interaction dynamics during different phases

  • What are the best approaches to quantify SMARCAL1-dependent effects on immune cell populations in tumor models?

    To quantify SMARCAL1's effects on tumor immune infiltration:

    • Flow cytometry: Comprehensive immune cell profiling using multi-parameter panels to identify and quantify:

      • T cell subsets (CD4+, CD8+, Tregs, memory, effector)

      • B cells (memory, plasma cells)

      • Myeloid cells (macrophages, neutrophils, MDSCs)

      • NK cells and NKT cells

      • Dendritic cell subsets

    • Spatial analysis techniques:

      • Multiplex immunohistochemistry or immunofluorescence to preserve spatial context

      • Digital spatial profiling for high-plex analysis of tumor microenvironment

      • Cell neighborhood analysis to identify altered immune cell interactions

    • Functional assays:

      • Ex vivo T cell killing assays with tumor cells expressing or lacking SMARCAL1

      • Cytokine profiling of tumor-infiltrating lymphocytes

      • Assessment of immune checkpoint receptor expression

    • In vivo approaches:

      • SMARCAL1 conditional knockout in tumor cells within immunocompetent mouse models

      • Adoptive transfer experiments to track specific immune populations

      • Antibody depletion of specific immune subsets to identify which are essential for SMARCAL1-mediated effects

      • Combination therapy models with immune checkpoint inhibitors

    • Single-cell analyses:

      • scRNA-seq of tumor immune infiltrates

      • TCR/BCR repertoire analysis to assess clonal expansion

      • CyTOF for high-dimensional protein profiling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.