SMARCAL1 antibodies are immunological reagents specifically designed to recognize and bind the SMARCAL1 protein (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of Chromatin, Subfamily A-Like 1), also known as HARP (HepA-related protein) or HHARP. These antibodies serve as essential research tools for detecting, visualizing, and analyzing SMARCAL1 expression, localization, and interactions within cellular contexts .
SMARCAL1 belongs to the SWI/SNF family of helicase and ATPase proteins, which are pivotal in chromatin remodeling processes. The protein is predominantly localized in the nucleus, where it performs critical ATP-dependent nucleosome-remodeling activities that facilitate DNA accessibility for transcription and repair processes. With a molecular weight of approximately 105-106 kDa, SMARCAL1 protein consists of 954 amino acids and includes one conserved C-terminal SNF2 domain, one helicase ATP-binding domain, and two HARP domains .
Commercial SMARCAL1 antibodies are produced through immunization procedures using synthetic peptides or recombinant protein fragments corresponding to specific regions of the human SMARCAL1 protein. These antibodies are available in various forms, including monoclonal and polyclonal variants, each offering distinct advantages for different research applications.
SMARCAL1 antibodies are available in several formulations that determine their application versatility:
| Antibody Type | Host Species | Clonality | Common Format | Companies |
|---|---|---|---|---|
| Anti-SMARCAL1 | Mouse | Monoclonal (E-12, A-2) | Unconjugated | Santa Cruz Biotechnology |
| Anti-SMARCAL1 | Rabbit | Monoclonal (D3P5I) | Unconjugated | Cell Signaling Technology |
| Anti-SMARCAL1 | Rabbit | Polyclonal | Unconjugated | Proteintech, Sigma-Aldrich, Abcam |
| Anti-SMARCAL1 | Rabbit | Polyclonal | HRP-conjugated | CUSABIO |
| Anti-SMARCAL1 | Rabbit | Polyclonal | FITC-conjugated | CUSABIO |
| Anti-SMARCAL1 | Rabbit | Polyclonal | Biotin-conjugated | CUSABIO |
Most commercially available antibodies are provided in liquid form, often buffered in solutions containing stabilizers such as sodium azide and glycerol to maintain reactivity during storage .
The specificity and performance of SMARCAL1 antibodies largely depend on the immunogen used in their production:
Cell Signaling Technology's D3P5I antibody is produced by immunizing animals with a synthetic peptide corresponding to residues surrounding Ala933 of human SMARCAL1 protein .
Sigma-Aldrich's antibody (HPA020337) utilizes an immunogen sequence covering a specific region of the SMARCAL1 protein: "SYELGQGHAQASPEIRFTPFANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQKGKCVRNGDRFQVLIGYNAELIAVFKTLPSKNYDPDTKTWNFS" .
Proteintech's antibody (12513-1-AP) is generated against a SMARCAL1 fusion protein designated Ag3194 .
Abcam's rabbit polyclonal antibody (ab154226) targets a recombinant fragment within human SMARCAL1 amino acids 100-500 .
SMARCAL1 antibodies demonstrate utility across multiple experimental techniques, allowing researchers to investigate this protein from different perspectives.
The primary applications of SMARCAL1 antibodies include:
| Application | Recommended Dilution Range | Notable Products |
|---|---|---|
| Western Blotting (WB) | 1:500-1:5000 | Most commercial antibodies |
| Immunoprecipitation (IP) | 1:50 | Cell Signaling Technology #44717, Abcam ab154226 |
| Immunofluorescence (IF) | 1:50-1:200 | Santa Cruz sc-166209, Sigma-Aldrich HPA020337 |
| Enzyme-Linked Immunosorbent Assay (ELISA) | Varies by product | CUSABIO antibodies |
| Immunohistochemistry (IHC) | 1:200-1:500 | Sigma-Aldrich HPA020337, Proteintech 12513-1-AP |
When performing Western blotting, SMARCAL1 is typically detected at approximately 105-106 kDa, which corresponds to its predicted molecular weight. For optimal results, researchers must carefully titrate antibody concentrations based on the specific sample type and experimental conditions .
Most commercially available SMARCAL1 antibodies are designed to detect human SMARCAL1, though some may cross-react with other species due to sequence homology. Researchers should verify species reactivity before experimental use, especially when working with non-human models .
For successful detection of SMARCAL1, proper sample preparation is essential:
For Western blotting, samples are typically separated on 4-12% or 5% SDS-PAGE gels.
For immunofluorescence, fixation methods may affect epitope accessibility.
For immunohistochemistry, antigen retrieval techniques may be necessary to expose the target epitope.
Understanding the structure and function of SMARCAL1 is crucial for interpreting antibody-based experimental results and developing targeted research strategies.
SMARCAL1 is characterized by several functional domains that contribute to its biological activities:
One conserved C-terminal SNF2 domain
One helicase ATP-binding domain
Two HARP (HepA-related protein) domains
These structural elements enable SMARCAL1 to function as an ATP-dependent annealing helicase that selectively binds fork DNA relative to single-stranded DNA (ssDNA) or double-stranded DNA (dsDNA) .
SMARCAL1 performs several critical functions within the cellular environment:
DNA Damage Response: SMARCAL1 is phosphorylated by DNA repair kinases (ATM, ATR, DNA-PK) during replication stress, participating in the stabilization and repair of stalled replication forks .
Chromatin Remodeling: As part of the SWI/SNF family, SMARCAL1 facilitates ATP-dependent nucleosome remodeling, making DNA more accessible for transcription and repair processes .
DNA Rewinding: SMARCAL1 catalyzes the rewinding of stably unwound DNA, essentially performing the opposite reaction of helicases and polymerases that unwind DNA .
Replication Fork Stability: SMARCAL1 deficiency sensitizes cells to replication stress agents and increases the frequency of replication fork breakdown .
Double-Strand Break Repair: SMARCAL1 contributes to efficient DNA double-strand break repair via the nonhomologous end joining (NHEJ) pathway .
The clinical significance of SMARCAL1 has been established through genetic studies and expression analyses in various pathological conditions.
Mutations in the SMARCAL1 gene cause Schimke immuno-osseous dysplasia (SIOD), an autosomal recessive disorder characterized by multiple phenotypic manifestations:
Spondyloepiphyseal dysplasia
Renal dysfunction
T cell immunodeficiency
The diverse phenotypes associated with SIOD reflect SMARCAL1's multifunctional role in maintaining cellular homeostasis and proper immune function .
Recent research has revealed significant connections between SMARCAL1 expression and cancer development:
SMARCAL1 is overexpressed in several cancer types, including Glioma, Lung Adenocarcinoma (LUAD), Kidney Renal Clear Cell Carcinoma (KIRC), and Liver Hepatocellular Carcinoma (LIHC) .
Elevated SMARCAL1 expression correlates with poor outcomes in Glioma, LUAD, and LIHC, though interestingly, it associates with better survival in KIRC, suggesting context-dependent effects .
SMARCAL1 deficiency has been linked to predisposition to non-Hodgkin's lymphoma, highlighting its role in maintaining genomic stability .
Recent studies utilizing SMARCAL1 antibodies have yielded significant insights into the protein's roles in cellular processes and disease mechanisms.
A groundbreaking 2024 study identified SMARCAL1 as a dual regulator that favors tumor immune evasion through two distinct mechanisms:
Suppression of Innate Immune Signaling: SMARCAL1 limits endogenous DNA damage, thereby suppressing cGAS-STING-dependent signaling during cancer cell growth .
Induction of Immune Checkpoint Responses: SMARCAL1 cooperates with the AP-1 family member JUN to maintain chromatin accessibility at a PD-L1 transcriptional regulatory element, promoting PD-L1 expression in cancer cells .
These findings suggest that SMARCAL1 inhibition could enhance anti-tumor immune responses and sensitize tumors to immune checkpoint blockade therapy.
A comprehensive pan-cancer analysis published in February 2025 evaluated SMARCAL1 expression across 33 cancer types using TCGA, GTEx, and CCLE databases. Key findings included:
Significant associations between SMARCAL1 expression and DNA methylation in 13 cancer types.
Correlation between SMARCAL1 expression and immune infiltration.
Identification of SMARCAL1 as a potential therapeutic target in cancer immunotherapy .
Analysis of SMARCAL1 expression in cancer patient datasets has revealed important clinical correlations:
SMARCAL1 is overexpressed in most human tumors.
Patients with low SMARCAL1 expression show downregulation of cell proliferation pathways and upregulation of inflammatory response pathways.
Low SMARCAL1 expression correlates with reduced PD-L1 expression in 85% of tumor types.
Patients responding to anti-PD-1 immunotherapy express lower levels of SMARCAL1 relative to non-responders .
These observations highlight the potential value of SMARCAL1 as a biomarker for predicting immunotherapy response and as a therapeutic target for enhancing anti-tumor immunity.
The evolving understanding of SMARCAL1 biology suggests several promising directions for future research and applications.
Targeting SMARCAL1 holds promise for enhancing cancer treatment efficacy:
SMARCAL1 inhibition could sensitize cancer cells to chemotherapeutic agents by compromising DNA repair mechanisms .
Combined approaches targeting SMARCAL1 and immune checkpoint blockade may provide synergistic benefits in cancer immunotherapy .
Development of small molecule inhibitors specifically targeting SMARCAL1's enzymatic activity could represent a novel therapeutic strategy.
SMARCAL1 antibodies may prove valuable in diagnostic and prognostic applications:
Assessment of SMARCAL1 expression levels could help predict patient responses to immunotherapy.
Monitoring SMARCAL1 phosphorylation status might serve as a biomarker for replication stress and genomic instability.
Evaluation of SMARCAL1 expression patterns across tumor types may contribute to more precise cancer classification and treatment selection.
Future development of SMARCAL1 antibodies may focus on:
Generating antibodies with enhanced specificity for different SMARCAL1 phosphorylation states.
Creating antibodies targeting specific functional domains to investigate domain-specific functions.
Developing nanobodies or intrabodies for real-time tracking of SMARCAL1 dynamics in living cells.
SMARCAL1 is a SNF2-family DNA translocase involved in maintaining genome stability by facilitating DNA rearrangement and repair . Recent research has identified SMARCAL1 as a dual regulator in tumor immune evasion, making it especially significant in cancer research. It functions by both suppressing innate immune signaling (by limiting endogenous DNA damage that would trigger cGAS-STING-dependent signaling) and simultaneously inducing PD-L1-mediated immune checkpoint responses . This dual functionality makes SMARCAL1 a promising target for cancer immunotherapy, as its expression correlates with immune infiltration across multiple cancer types .
SMARCAL1 antibodies are valuable tools for:
Immunoblotting/Western blot analysis to detect SMARCAL1 protein levels in cellular extracts
Immunoprecipitation to study protein-protein interactions, such as its association with RPA
Immunofluorescence microscopy to visualize nuclear localization and co-localization with DNA damage response proteins like RPA32 and RAD51
Chromatin immunoprecipitation (ChIP) assays to investigate SMARCAL1's role in maintaining chromatin accessibility at regulatory elements, particularly for genes like PD-L1
Flow cytometry for analyzing SMARCAL1 expression levels in tumor samples
Pan-cancer analysis has revealed significant variation in SMARCAL1 expression across cancer types:
Overexpression has been observed in several cancers, including Glioma, Lung Adenocarcinoma (LUAD), Kidney Renal Clear Cell Carcinoma (KIRC), and Liver Hepatocellular Carcinoma (LIHC)
The prognostic significance of SMARCAL1 expression differs by cancer type - elevated expression correlates with poor outcomes in Glioma, LUAD, and LIHC, but interestingly associates with better survival in KIRC
SMARCAL1 expression correlates with DNA methylation patterns in 13 different cancer types, suggesting epigenetic regulation plays a role in its expression
Expression levels also correlate with tumor mutational burden (TMB) in several cancers, including Glioma (R = 0.16), LUAD (R = 0.16), and KIRC (R = 0.11)
When designing experiments with SMARCAL1 antibodies, include the following controls:
Positive controls: Cell lines known to express SMARCAL1 (e.g., U2OS cells which have been used in SMARCAL1-GFP expression studies)
Negative controls: SMARCAL1 knockdown or knockout samples created using RNAi or CRISPR techniques
Isotype controls: Antibodies of the same isotype but irrelevant specificity to assess non-specific binding
Peptide competition assays: Pre-incubating the antibody with the immunizing peptide to confirm specificity
Cross-reactivity testing: When working with model organisms, verify the antibody's species reactivity (particularly important as studies have utilized both human and Xenopus SMARCAL1)
SMARCAL1 affects immune infiltration through multiple mechanisms:
It demonstrates significant correlations with CD4 T cell, CD8 T cell, and T helper cell infiltration across multiple cancer types
Cancer-specific patterns show that SMARCAL1 expression positively correlates with:
Negative correlations exist with:
SMARCAL1 suppresses cGAS-STING-dependent signaling by limiting endogenous DNA damage, which otherwise would trigger innate immune responses
Additionally, it regulates PD-L1 expression, a key immune checkpoint protein that inhibits T cell function in the tumor microenvironment
To address contradictory findings regarding SMARCAL1 function across cell types:
Perform parallel knockdown/knockout studies in multiple cell lines representing different tissue origins
Utilize rescue experiments with wildtype versus mutant SMARCAL1 to identify domain-specific functions
Conduct comparative ChIP-seq across cell types to map differential genomic binding sites
Implement RNA-seq following SMARCAL1 depletion to identify cell-type specific transcriptional responses
Apply proteomics approaches (IP-MS) to characterize cell-type specific SMARCAL1 interaction partners
Develop inducible expression systems to study acute versus chronic effects of SMARCAL1 modulation
Examine post-translational modifications that might alter SMARCAL1 function in a context-dependent manner
Use single-cell approaches to address heterogeneity within populations that might explain contradictory findings
To effectively study SMARCAL1's dual regulatory roles:
For cGAS-STING pathway suppression:
Monitor cytosolic DNA levels using DNA-specific dyes or anti-DNA antibodies in SMARCAL1-depleted versus control cells
Quantify cGAS-bound DNA using ChIP or proximity ligation assays
Measure STING activation by assessing its dimerization, phosphorylation, and translocation
Analyze downstream signaling through TBK1 and IRF3 phosphorylation
Quantify type I interferon production and ISG (Interferon Stimulated Gene) expression
For PD-L1 regulation:
Perform ChIP-seq for SMARCAL1 and JUN at the PD-L1 locus
Use ATAC-seq to assess chromatin accessibility changes at PD-L1 regulatory elements upon SMARCAL1 manipulation
Implement CUT&RUN or CUT&Tag for high-resolution mapping of SMARCAL1 binding sites
Analyze histone modifications at the PD-L1 locus in response to SMARCAL1 depletion
Conduct reporter assays with wildtype and mutant PD-L1 regulatory elements
Use 3C/4C/Hi-C techniques to assess long-range chromatin interactions impacted by SMARCAL1
For integrated studies:
Create separation-of-function SMARCAL1 mutants that specifically disrupt either DNA damage suppression or transcriptional regulation
Use single-cell multi-omics to correlate DNA damage, immune signaling, and PD-L1 expression in individual cells
Develop inducible systems to temporally separate SMARCAL1's effects on DNA damage and gene regulation
ChIP assays with SMARCAL1 antibodies present several technical challenges:
Epitope accessibility issues: SMARCAL1's interaction with chromatin may obscure antibody epitopes
Cross-linking effects: Standard formaldehyde cross-linking might interfere with antibody recognition of SMARCAL1
Transient interactions: SMARCAL1's dynamic association with chromatin may result in low signal-to-noise ratios
Specificity concerns: SMARCAL1 belongs to the SNF2 family, which has multiple members with similar domains
Wash conditions: Optimizing salt and detergent concentrations is crucial to maintain specific interactions while reducing background
Methodological solutions include:
Testing multiple antibodies targeting different SMARCAL1 epitopes
Comparing native ChIP versus cross-linked ChIP approaches
Implementing epitope-tagged versions of SMARCAL1 for ChIP using tag-specific antibodies
Using dual cross-linking strategies (formaldehyde + DSG/EGS) to capture transient interactions
Adapting specialized ChIP protocols for factors involved in DNA replication and repair
Incorporating spike-in controls to normalize for technical variation
Validating ChIP-seq findings with orthogonal methods such as CUT&RUN or CUT&Tag
The SMARCAL1-RPA interaction is critical for SMARCAL1 function and can be studied using:
Co-immunoprecipitation (Co-IP): Immunoprecipitate SMARCAL1 and blot for RPA subunits (particularly RPA70 and RPA32) or vice versa
Proximity ligation assay (PLA): Visualize and quantify SMARCAL1-RPA interactions in situ with high sensitivity
FRET or BiFC: Monitor direct protein-protein interactions in living cells using fluorescently tagged proteins
Domain mapping: Create truncated constructs of SMARCAL1, particularly focusing on the N-terminal region which contains the RPA-binding motif
Peptide competition assays: Use synthetic peptides corresponding to the N-terminal SMARCAL1 RPA-binding motif to disrupt interactions
Immunofluorescence co-localization: Analyze spatial overlap between SMARCAL1 and RPA at sites of DNA damage or stalled replication forks
ChIP-reChIP: Determine if SMARCAL1 and RPA bind simultaneously to the same DNA fragments
Assessing post-translational modifications: Investigate how phosphorylation of either protein affects their interaction
Control experiments should include:
DNase treatment to distinguish direct protein interactions from DNA-mediated associations
RPA binding-deficient SMARCAL1 mutants as negative controls
Cell cycle synchronization to assess interaction dynamics during different phases
To quantify SMARCAL1's effects on tumor immune infiltration:
Flow cytometry: Comprehensive immune cell profiling using multi-parameter panels to identify and quantify:
T cell subsets (CD4+, CD8+, Tregs, memory, effector)
B cells (memory, plasma cells)
Myeloid cells (macrophages, neutrophils, MDSCs)
NK cells and NKT cells
Dendritic cell subsets
Spatial analysis techniques:
Multiplex immunohistochemistry or immunofluorescence to preserve spatial context
Digital spatial profiling for high-plex analysis of tumor microenvironment
Cell neighborhood analysis to identify altered immune cell interactions
Functional assays:
Ex vivo T cell killing assays with tumor cells expressing or lacking SMARCAL1
Cytokine profiling of tumor-infiltrating lymphocytes
Assessment of immune checkpoint receptor expression
In vivo approaches:
SMARCAL1 conditional knockout in tumor cells within immunocompetent mouse models
Adoptive transfer experiments to track specific immune populations
Antibody depletion of specific immune subsets to identify which are essential for SMARCAL1-mediated effects
Combination therapy models with immune checkpoint inhibitors
Single-cell analyses:
scRNA-seq of tumor immune infiltrates
TCR/BCR repertoire analysis to assess clonal expansion
CyTOF for high-dimensional protein profiling