The SMARCD2 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2) antibody conjugated with Fluorescein Isothiocyanate (FITC) is a critical tool for detecting SMARCD2 protein in experimental workflows. This antibody facilitates visualization of SMARCD2’s role in chromatin remodeling and transcriptional regulation, particularly in studies requiring fluorescence-based detection methods .
The antibody targets a synthetic peptide corresponding to residues 440–489 of human SMARCD2 (UniProt: Q92925-2). This region is highly conserved across species, with 100% homology in cow, dog, horse, and rabbit, and 93% in zebrafish . The epitope sequence is:
FRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDI
The antibody demonstrates broad reactivity, validated in:
| Species | Homology |
|---|---|
| Human | 100% |
| Mouse | 100% |
| Rat | 100% |
| Zebrafish | 93% |
| Dog, Cow, Horse | 100% |
Recommended Dilution: Not explicitly stated, but titration is advised for optimal results .
Observed Molecular Weight: 59 kDa (aligns with UniProt’s predicted 52–59 kDa range) .
SMARCD2 is a subunit of the SWI/SNF chromatin remodeling complex, critical for myeloid differentiation and hematopoiesis. Key findings include:
Role in Myelopoiesis: SMARCD2 regulates granulocyte differentiation by interacting with transcription factors like CEBPε. Loss-of-function mutations cause neutropenia and myelodysplasia .
Leukemia Implications: SMARCD2 deficiency disrupts chromatin accessibility in acute myeloid leukemia (AML) cells, suggesting tumor suppressor activity .
Mechanistic Insights: SMARCD2 integrates with SWI/SNF complexes to modulate granulocyte-specific gene expression (e.g., CAMP, LTF, MMP8) .
SMARCD2, also known as BAF60B, is a subunit of the SWI/SNF chromatin remodeling complex that plays a crucial role in controlling gene expression and cell fate determination. It functions primarily in the nucleus where it participates in chromatin remodeling to regulate accessibility of transcription factors to DNA. SMARCD2 has been directly implicated in transcriptional regulation through its ability to remodel chromatin structure, particularly in processes related to hematopoietic differentiation. Loss-of-function mutations in SMARCD2 have been associated with immunodeficiency and developmental disorders, suggesting its essential role in normal cellular development and function .
FITC-conjugated SMARCD2 antibodies typically consist of rabbit polyclonal antibodies specific to human SMARCD2 protein that have been chemically linked to fluorescein isothiocyanate (FITC). These antibodies are generated using recombinant fusion proteins of human SMARCD2 as immunogens, often targeting specific amino acid sequences. The FITC fluorophore has excitation/emission wavelengths of approximately 495/519 nm, making it compatible with the 488 nm laser line commonly used in flow cytometry and fluorescence microscopy . The antibodies typically recognize the full-length SMARCD2 protein with a calculated molecular weight of approximately 59-64 kDa and are designed to maintain high specificity while exhibiting minimal background fluorescence .
FITC-conjugated SMARCD2 antibodies provide distinct advantages and limitations compared to other fluorophore conjugates. FITC emits green fluorescence (emission peak ~519 nm) which contrasts with other available conjugates such as AF350 (emission ~442 nm), AF405 (emission ~421 nm), AF555 (emission ~565 nm), and AF647 (emission ~667 nm) . This spectral characteristic allows for multicolor experimental design, but researchers must consider that FITC has relatively rapid photobleaching compared to Alexa Fluor conjugates. Additionally, FITC fluorescence is pH-sensitive and optimal at slightly alkaline conditions (pH >7.5), whereas other conjugates like AF594 or AF647 maintain stable fluorescence across a broader pH range. In multiplexed experiments, FITC can be effectively combined with red-emitting fluorophores (e.g., AF647) while minimizing spectral overlap, though careful compensation controls are required when used with PE (phycoerythrin) due to potential bleed-through .
For optimal immunofluorescence staining with FITC-conjugated SMARCD2 antibody, follow this methodological approach:
Fixation and Permeabilization:
Fix cells with 4% paraformaldehyde for 15 minutes at room temperature
Permeabilize with 0.1% Triton X-100 in PBS for 10 minutes (critical for nuclear antigen access)
Blocking and Antibody Incubation:
Nuclear Counterstaining and Mounting:
Counterstain nuclei with DAPI (1 μg/ml) for 5 minutes
Mount with anti-fade mounting medium specifically formulated for fluorescence preservation
Imaging Parameters:
Use appropriate filter sets (excitation: 495±10 nm, emission: 519±10 nm)
Minimize exposure time to prevent photobleaching of FITC
Acquire Z-stack images to fully capture nuclear localization of SMARCD2
For optimal results, maintain samples in darkness whenever possible and process all experimental and control samples identically. Include appropriate controls including secondary antibody-only controls to assess background fluorescence .
Validating the specificity of FITC-conjugated SMARCD2 antibodies requires a multi-faceted approach:
Positive and Negative Control Tissues/Cells:
Competitive Peptide Blocking:
Multi-antibody Validation:
Compare staining patterns using different antibodies targeting distinct SMARCD2 epitopes
Concordant staining patterns support specificity
Genetic Validation:
Perform parallel experiments with SMARCD2 knockdown/knockout cells
Reduced or absent signal in these samples confirms specificity
Use siRNA or CRISPR-Cas9 systems targeting SMARCD2
Western Blot Correlation:
Cross-reactivity Assessment:
Documentation of these validation steps is essential for publication-quality research and reproducibility .
For flow cytometry analysis using FITC-conjugated SMARCD2 antibodies, follow these methodological guidelines:
Cell Preparation:
Harvest cells in exponential growth phase (1-5 × 10^6 cells per sample)
Wash twice with ice-cold PBS containing 2% FBS
Maintain samples at 4°C throughout preparation to preserve cellular integrity
Fixation and Permeabilization (Critical for Nuclear Antigen):
Fix cells with 4% paraformaldehyde for 15 minutes at room temperature
Permeabilize with either:
a) 0.1% Triton X-100 in PBS for 10 minutes at room temperature, or
b) 90% ice-cold methanol for 30 minutes on ice (preferred for robust nuclear permeabilization)
Blocking and Antibody Staining:
Block with 5% normal serum in PBS for 30 minutes at room temperature
Incubate with FITC-conjugated SMARCD2 antibody (typically 1:50-1:100 dilution) for 45-60 minutes at room temperature in the dark
Wash three times with PBS containing 2% FBS
Controls and Analysis Parameters:
Include unstained cells, isotype control, and single-color controls for compensation
Analyze using 488 nm laser excitation and 525/40 nm bandpass filter
Set PMT voltage to position negative population in first decade of log scale
Collect minimum of 10,000 events per sample
Data Analysis Considerations:
Gate on single cells using FSC-H vs. FSC-A to exclude doublets
Gate on viable cells if using a viability dye
Present data as histogram overlays or median fluorescence intensity values
For optimal results, prepare freshly conjugated antibody or use within 6 months when stored protected from light at 4°C .
FITC-conjugated SMARCD2 antibodies can be strategically employed to investigate SWI/SNF complex assembly and function through several advanced methodological approaches:
Co-immunoprecipitation with Fluorescence Detection:
Use FITC-conjugated SMARCD2 antibodies to immunoprecipitate the protein complex
Analyze co-precipitating partners such as SMARCA4 (BRG1), SMARCC2 (BAF170), SMARCC1 (BAF155), and SMARCB1 (BAF47)
Quantify relative fluorescence intensity to assess complex composition under different cellular conditions
Chromatin Immunoprecipitation followed by Sequencing (ChIP-seq):
Implement a modified ChIP protocol using FITC-conjugated SMARCD2 antibodies
Isolate SMARCD2-bound chromatin regions
Sequence and analyze to identify genomic binding sites and assess overlap with transcription factor binding sites
Compare binding profiles in wild-type versus mutant cells to understand functional implications
FRET (Förster Resonance Energy Transfer) Analysis:
Combine FITC-conjugated SMARCD2 antibodies with another SWI/SNF component antibody labeled with a compatible acceptor fluorophore
Measure FRET efficiency to assess protein-protein proximity within the complex
Apply in live or fixed cells to study dynamic changes in complex assembly
High-Content Screening with Quantitative Image Analysis:
Utilize automated microscopy platforms to analyze SMARCD2 localization across thousands of cells
Implement machine learning algorithms to classify subcellular distribution patterns
Correlate with functional readouts during differentiation or disease progression
This multimodal approach enables researchers to decipher both compositional and functional aspects of SWI/SNF complexes containing SMARCD2, providing insights into chromatin remodeling mechanisms that regulate gene expression networks critical for cellular differentiation and disease pathogenesis .
When studying SMARCD2 mutations using fluorescence-based techniques, researchers should implement the following experimental design considerations:
Mutation-Specific Epitope Accessibility Assessment:
Determine whether the FITC-conjugated antibody's epitope region (e.g., amino acids 454-531) is affected by the mutation being studied
For frameshift mutations like p.Arg73Valfs*8, assess potential truncation effects on epitope recognition
Consider multiple antibodies targeting different epitopes for comprehensive analysis
Expression Vector System Design:
Quantitative Co-localization Analysis:
Implement rigorous co-localization metrics (Pearson's correlation coefficient, Manders' overlap coefficient)
Compare wild-type and mutant SMARCD2 co-localization with other SWI/SNF components
Use high-resolution techniques (confocal, super-resolution microscopy) for precise spatial information
Functional Rescue Experimental Design:
Design complementation studies with fluorescence readouts
Express wild-type SMARCD2 in mutant/knockout backgrounds
Quantify restoration of proper nuclear localization and complex formation
Controls for Fluorescence Studies:
Multiparametric Flow Cytometry Panel Design:
Combine FITC-conjugated SMARCD2 antibody with markers of cell differentiation
Implement careful compensation when using FITC alongside PE-conjugated antibodies
Include appropriate FMO (Fluorescence Minus One) controls
This comprehensive approach enables accurate assessment of how SMARCD2 mutations affect protein localization, complex formation, and function in various cellular contexts .
Implementing multiplexed imaging with FITC-conjugated SMARCD2 antibodies requires careful optimization of several technical parameters:
Strategic Fluorophore Selection:
Pair FITC (excitation 495 nm/emission 519 nm) with spectrally distinct fluorophores
Optimal companions include:
Avoid PE conjugates when possible due to spectral overlap with FITC
Sequential Staining Protocol:
Block with 5% BSA in PBS-T for 1 hour at room temperature
Apply primary antibodies sequentially for multi-species antibodies
For nuclear SMARCD2 detection, apply the FITC-conjugated antibody last in the sequence
Include 10-minute PBS washes (3×) between each antibody application
Image Acquisition Parameters:
Capture single-color controls for spectral unmixing
Implement sequential scanning rather than simultaneous acquisition
Begin with FITC channel (most susceptible to photobleaching)
Optimize exposure settings individually for each channel
Post-Acquisition Analysis:
Apply spectral unmixing algorithms to remove bleed-through
Implement colocalization analysis using Pearson's or Manders' coefficients
Utilize 3D reconstruction for nuclear proteins like SMARCD2
Experimental Controls for Multiplexed Imaging:
Single-label controls for each fluorophore
FMO (Fluorescence Minus One) controls
Secondary antibody-only controls to assess background
Absorption controls to ensure antibody penetration into nuclear regions
This comprehensive approach enables simultaneous visualization of SMARCD2 alongside other proteins of interest, allowing researchers to investigate protein interactions within the SWI/SNF complex and its relationship with other nuclear components .
Researchers frequently encounter several technical challenges when working with FITC-conjugated SMARCD2 antibodies. Here are the most common issues and their methodological solutions:
Photobleaching:
Problem: Rapid signal loss during imaging due to FITC's susceptibility to photobleaching
Solutions:
pH Sensitivity:
Problem: Decreased fluorescence in acidic environments
Solutions:
Maintain buffers at pH 7.4-8.0 throughout all experimental steps
Avoid acidic fixatives when possible
Use buffered mounting media specifically designed for fluorescence preservation
High Background Fluorescence:
Problem: Poor signal-to-noise ratio
Solutions:
Inadequate Nuclear Signal:
Problem: Weak or absent nuclear staining despite SMARCD2's nuclear localization
Solutions:
Ensure robust permeabilization (0.5% Triton X-100 for 15 minutes or methanol fixation)
Implement heat-mediated antigen retrieval (citrate buffer pH 6.0 or TE buffer pH 9.0)
Extend primary antibody incubation to overnight at 4°C
Verify antibody functionality with positive control samples (mouse/rat thymus)
Spectral Overlap in Multiplexed Experiments:
By systematically addressing these technical challenges, researchers can significantly improve the quality and reliability of their SMARCD2 detection experiments.
To ensure scientific rigor when working with FITC-conjugated SMARCD2 antibodies, researchers should implement the following validation approaches:
Orthogonal Detection Methods:
Confirm fluorescence microscopy findings with independent techniques:
Compare results across multiple detection platforms to confirm consistency
Genetic Validation Strategies:
Implement SMARCD2 knockdown/knockout controls:
siRNA-mediated transient knockdown
CRISPR-Cas9 engineered knockout cell lines
Conditional knockout models for tissue-specific validation
Document proportional signal reduction corresponding to protein depletion level
Antibody Cross-Validation:
Compare results using multiple antibodies targeting different SMARCD2 epitopes
Validate with both polyclonal and monoclonal antibodies when available
Test antibodies from different vendors with documented epitope information
Functional Correlation Studies:
Statistical Robustness Measures:
Implement quantitative image analysis:
Measure fluorescence intensity across multiple fields/samples
Quantify nuclear/cytoplasmic distribution ratios
Apply appropriate statistical tests (minimum n=3 biological replicates)
Report effect sizes and confidence intervals rather than just p-values
Reproducibility Assessment:
Test antibody performance across:
Multiple lots
Different experimental days
Independent operators
Document all experimental conditions thoroughly to enable reproduction
By implementing these rigorous validation strategies, researchers can establish confidence in their experimental results and contribute to reliable knowledge advancement in SMARCD2 biology .
FITC-conjugated SMARCD2 antibodies present powerful opportunities for single-cell analysis through several cutting-edge methodological approaches:
Single-Cell Imaging Flow Cytometry:
Combine quantitative flow cytometry with high-resolution imaging
Measure SMARCD2 nuclear localization intensity alongside morphological parameters
Correlate SMARCD2 expression with cell cycle phases using DNA content staining
Implement machine learning algorithms to classify cellular subpopulations based on SMARCD2 distribution patterns
Mass Cytometry (CyTOF) Integration:
Develop metal-tagged SMARCD2 antibodies based on validated FITC-conjugated clones
Integrate into high-dimensional panels (30+ parameters) including:
Other SWI/SNF complex members
Transcription factors
Chromatin modification markers
Apply dimensionality reduction techniques (tSNE, UMAP) to identify novel cellular states
Single-Cell Multi-omics Applications:
Implement CITE-seq approaches combining:
FITC-conjugated SMARCD2 antibody detection
Single-cell transcriptomics
Chromatin accessibility profiling
Correlate protein levels with gene expression and chromatin states at single-cell resolution
Spatial Transcriptomics Integration:
Combine FITC-conjugated SMARCD2 immunofluorescence with in situ transcriptomics
Map spatial relationships between SMARCD2-expressing cells and specific transcriptional programs
Develop computational approaches to correlate protein localization with spatially resolved gene expression
Live-Cell Imaging Applications:
Utilize cell-permeable nanobody-based derivatives of validated SMARCD2 antibodies
Track dynamic changes in SMARCD2 localization during differentiation or disease progression
Implement FRAP (Fluorescence Recovery After Photobleaching) to assess SMARCD2 mobility within nuclear compartments
These advanced single-cell approaches will enable researchers to decipher heterogeneity in SMARCD2 expression and function across diverse cell populations, potentially revealing novel insights into its role in development, differentiation, and disease pathogenesis .
Several cutting-edge research areas could benefit substantially from applications of FITC-conjugated SMARCD2 antibodies:
Hematopoietic Stem Cell Differentiation:
Chromatin Architecture and Nuclear Organization:
Combine with super-resolution microscopy (STORM, PALM) to map SMARCD2 distribution at nanoscale resolution
Investigate co-localization with topologically associating domains (TADs) and chromatin loops
Explore potential role in phase separation within the nucleus through quantitative imaging
Cancer Biology and Precision Medicine:
Profile SMARCD2 expression across tumor subtypes using tissue microarrays
Correlate with treatment response and patient outcomes
Develop potential diagnostic or prognostic applications based on SMARCD2 expression patterns
Developmental Biology:
Map SMARCD2 expression during embryonic development in model organisms
Investigate role in tissue-specific differentiation programs
Explore potential developmental origins of SMARCD2-associated disorders
Immunological Research:
Investigate SMARCD2's role in immune cell function and differentiation
Explore potential connections to immunodeficiency disorders
Develop therapeutic strategies targeting SMARCD2-dependent pathways
Regenerative Medicine:
Utilize FITC-conjugated SMARCD2 antibodies to monitor cellular reprogramming
Assess SMARCD2 dynamics during induced pluripotent stem cell generation
Explore potential manipulation of SMARCD2 to enhance differentiation efficiency
These emerging research areas represent fertile ground for application of FITC-conjugated SMARCD2 antibodies, particularly as they relate to understanding fundamental mechanisms of chromatin remodeling in development and disease contexts .
Maintaining optimal performance of FITC-conjugated SMARCD2 antibodies requires adherence to specific storage and handling protocols:
Storage Conditions:
For long-term storage, aliquot into single-use volumes and store at -20°C
Avoid repeated freeze-thaw cycles (limit to maximum 3 cycles)
Protect from light at all times using amber tubes or aluminum foil wrapping
Buffer Composition:
Optimal buffer: 0.01M Sodium Phosphate, 0.25M NaCl, pH 7.6, with 5mg/ml Bovine Serum Albumin and 0.02% Sodium Azide
This formulation maintains antibody stability while preventing microbial contamination
Working Solution Preparation:
Thaw aliquots completely before use and mix gently by inversion (avoid vortexing)
Centrifuge briefly (30 seconds at 10,000g) to collect contents before opening
Prepare working dilutions immediately before use
Do not store diluted antibody solutions for extended periods
Quality Control Measures:
Periodically validate antibody performance using positive control samples (mouse/rat thymus tissue)
Monitor for signs of degradation:
Diminished fluorescence intensity
Increased background staining
Altered staining pattern
Implement reference standards to ensure consistent performance across experiments
Handling Precautions:
Minimize exposure to light during all preparation and experimental steps
Work under reduced ambient lighting when preparing solutions
Use low-retention tubes and pipette tips to prevent protein adsorption
Implement aseptic technique to prevent microbial contamination
By adhering to these storage and handling recommendations, researchers can maximize the lifespan and performance consistency of their FITC-conjugated SMARCD2 antibodies across multiple experiments .
Researchers pursuing advanced studies of SMARCD2 can access various specialized resources:
Biological Resources:
Validated Cell Lines: SH-SY5Y (human neuroblastoma) and Jurkat (T lymphocyte) cell lines express detectable levels of SMARCD2
Tissue Resources: Mouse and rat thymus tissue serve as reliable positive controls
Genetic Models: SMARCD2 knockout/knockdown systems available through repositories like Jackson Laboratory and Addgene
Technical Resources:
Optimized Protocols:
Bioinformatics Tools:
Genomic Databases: ChIP-Atlas and ENCODE contain datasets on SMARCD2 binding sites
Protein Interaction Databases: BioGRID and STRING provide comprehensive interaction networks
Gene Expression Resources: GTEx and Human Protein Atlas offer tissue-specific expression data
Research Networks and Collaborations:
Chromatin Remodeling Consortia: International networks focused on SWI/SNF complex biology
Rare Disease Networks: Resources for researchers studying SMARCD2-related immunodeficiencies
Technology-Specific Communities: Forums for advanced imaging and single-cell analysis methods
Experimental Design Support:
Control Recommendations:
Specialized Methodologies:
Advanced Imaging: Super-resolution microscopy protocols optimized for nuclear proteins
Flow Cytometry: Multiparameter panels incorporating SMARCD2 detection
Mass Spectrometry: Protocols for SWI/SNF complex purification and analysis