SNF8 Antibody

What is SNF8 and why is it important in biomedical research?

SNF8 (GenBank: NM_007241.4) encodes a subunit of the ESCRT-II complex, which is crucial for membrane remodeling and autophagy. Recent research has identified bi-allelic variants in SNF8 associated with a spectrum of neurodevelopmental and neurodegenerative phenotypes . The protein is involved in:

• Endosomal trafficking and sorting

• Membrane remodeling processes

• Autophagy regulation

• Potentially IRF3-dependent innate antiviral defense

The significance of SNF8 in multiple cellular pathways makes it an important target for research investigating developmental disorders, neurodegeneration, and cellular trafficking mechanisms.

What are the key characteristics of commercially available SNF8 antibodies?

Available SNF8 antibodies come in various formats optimized for different experimental applications:

When selecting an antibody, researchers should consider the specific application needs and target species reactivity.

How should I design experiments to validate SNF8 antibody specificity for neurodevelopmental research?

Validation of SNF8 antibody specificity, particularly for neurodevelopmental studies, requires multiple approaches:

• Knockdown/Knockout Controls: Implement SNF8 knockdown (siRNA/shRNA) or knockout (CRISPR/Cas9) in relevant cell lines to confirm antibody specificity. Published literature indicates successful validation using KD/KO approaches .

• Multiple Detection Methods: Employ at least two different detection methods (e.g., WB and IHC or IF) to confirm consistent target recognition.

• Cross-Validation with Multiple Antibodies: Use antibodies targeting different epitopes of SNF8 to confirm findings.

• Species-Specific Validation: For neurodevelopmental studies spanning multiple species (e.g., human and zebrafish models), validate reactivity in each experimental system.

• Brain Tissue-Specific Controls: When examining brain tissue, include appropriate controls such as age-matched individuals without neurological conditions, as demonstrated in protocols for LC3 IHC .

Example validation protocol based on published methods: For IHC of brain tissue, implement antigen retrieval by boiling in citrate buffer (pH 6) for CR3/43 and NeuN markers, and in Tris/EDTA buffer (pH 8) for LC3 markers .

What experimental approaches are recommended for investigating SNF8's role in autophagy using antibody-based methods?

To investigate SNF8's role in autophagy, researchers should implement a multi-faceted approach:

• Co-localization Studies: Perform dual immunofluorescence with SNF8 antibodies and autophagy markers (e.g., LC3, LAMP1) to visualize potential co-localization, following protocols similar to those used in studies of autolysosomes in patient-derived fibroblasts .

• Autophagic Flux Assessment:

  • Treat cells with Bafilomycin A1 (B1793 Sigma) to inhibit lysosomal acidification

  • Compare LC3-II levels between treated and untreated samples using SNF8 antibody (dilution 1:400-1:1000)

  • Process for immunofluorescence confocal microscopy

• Patient-Derived Cell Models: Establish fibroblast cultures from individuals with SNF8 variants to examine autophagic defects, as demonstrated in previous research .

• Protein Complex Analysis: Investigate ESCRT-II complex integrity using co-immunoprecipitation with SNF8 antibodies (recommended dilution 1:500-1:3000 for Western blot) .

• RNA-Protein Correlation: Consider incorporating RNA-seq data to examine SNF8 expression patterns and correlate with protein levels detected by antibodies .

Western Blot Protocol:

• Prepare lysates from target tissue/cells (validated in HeLa, K-562 cells)

• Subject to SDS-PAGE and transfer to membrane

• Block with appropriate buffer (BSA or non-fat milk)

• Incubate with primary SNF8 antibody:

  • For monoclonal antibodies: dilution 1:500-1:3000

  • For polyclonal antibodies: dilution 1:20000-1:40000 for ELISA applications

• Wash and apply appropriate secondary antibody

• Develop using chemiluminescence or alternative detection methods

• Expected band at approximately 29-30 kDa

Immunohistochemistry Protocol:

• Process tissue sections through deparaffinization and rehydration

• Perform antigen retrieval:

  • For paraffin sections: TE buffer pH 9.0 or citrate buffer pH 6.0

• Block endogenous peroxidase and non-specific binding

• Incubate with primary SNF8 antibody:

  • Recommended dilution: 1:50-1:500 for IHC

  • Incubation time: typically overnight at 4°C

• Apply detection system and counterstain

• Validated in human breast cancer tissue

Immunofluorescence Protocol:

• Fix cells with 4% paraformaldehyde

• Permeabilize with 0.1-0.5% Triton X-100

• Block non-specific binding sites

• Incubate with primary SNF8 antibody at 1:50-1:500 dilution

• Apply fluorophore-conjugated secondary antibody

• Counterstain nuclei (e.g., DAPI) and mount

• Validated in HeLa cells

How can I validate SNF8 antibodies for specificity in my experimental system?

A comprehensive validation strategy includes:

• Specificity Testing:

  • Blocking peptide experiments: Use specific blocking peptides to confirm signal specificity

  • Protein array screening: Some antibodies are validated against arrays containing the target protein plus 383 non-specific proteins

• Cross-Reactivity Assessment:

  • Test against multiple species if cross-reactivity is claimed

  • Evaluate in tissues known to express and not express SNF8

• Quantitative Validation:

  • Compare RNA and protein expression patterns

  • Positive predictive value and sensitivity assessment similar to methods used in validation studies of other antibodies

• Signal-to-Noise Optimization:

  • Titrate antibody concentrations to determine optimal signal-to-noise ratio

  • For SNF8 monoclonal antibodies, test dilutions ranging from 1:50 to 1:3000 depending on application

• Orthogonal Validation:

  • Incorporate orthogonal data from paired proteomic and RNA studies to improve specificity

  • Remove markers with low RNA-protein correlation to enhance validation quality

How can SNF8 antibodies be integrated into studies of neurodevelopmental disorders associated with ESCRT-II dysfunction?

For neurodevelopmental research focusing on ESCRT-II dysfunction:

• Translational Biomarker Development:

  • Implement SNF8 antibody staining in patient-derived samples (fibroblasts, iPSCs, or neural organoids)

  • Compare SNF8 protein levels and localization between patients with neurodevelopmental phenotypes and controls

  • Correlate findings with severity of clinical manifestations (e.g., epileptic encephalopathy vs. milder ID)

• Animal Model Validation:

  • Use SNF8 antibodies to track protein expression in zebrafish models of SNF8 dysfunction

  • Correlate protein levels with phenotypic outcomes such as optic nerve development and forebrain size reduction

• Autophagy Assessment Pipeline:

  • Implement a sequential analysis of autophagic flux using LC3 and LAMP1 antibodies alongside SNF8 detection

  • Quantify autolysosome accumulation in patient-derived cells using co-localization analysis

  • Integrate findings with electron microscopy to assess lysosomal morphology

• Multi-omics Integration:

  • Combine SNF8 antibody-based proteomics with RNA-seq and functional assays

  • Use RNA integrity number (RIN) determination (Agilent 2100 BioAnalyzer) to ensure quality of complementary RNA studies

What are the challenges in interpreting contradictory results from different SNF8 antibodies, and how can they be resolved?

Resolving contradictory results requires systematic troubleshooting:

• Epitope Binding Differences:

  • Map the specific epitopes recognized by different antibodies

  • For example, some commercially available SNF8 antibodies target the sequence: WSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYL

  • Others may target different regions, leading to discrepancies

• Post-translational Modification Interference:

  • Determine if post-translational modifications affect epitope recognition

  • Test antibodies in samples treated with phosphatases or deglycosylation enzymes

• Structural Considerations:

  • Analyze the crystal structure of human ESCRT-II complex (PDB: 2ZME) to understand how protein folding may affect epitope accessibility

  • Implement native vs. denatured protein detection methods

• Validation Through Orthogonal Methods:

  • Implement RNA-protein correlation analysis similar to methods used in antibody screening studies, which have demonstrated correlations between 0.38 and 0.58 for other markers

  • Apply discretization of marker expression into high/low categories to assess predictive value

• Statistical Approach to Conflicting Data:

  • Implement statistical methods to evaluate the significance of contradictory results

  • Consider Bayesian approaches to integrate multiple lines of evidence

How can SNF8 antibodies be used to investigate the relationship between ESCRT-II function and stem cell populations?

Research integrating SNF8 antibodies with stem cell analysis can follow these methodological approaches:

• Stem Cell Population Identification:

  • Combine SNF8 antibodies with markers of specific stem/progenitor populations

  • For example, CD45-/CD146+/Nestin+ identifies osteoprogenitors in mice

  • Alternative markers such as Lin-CD45-CD105+CD29+ may identify different subsets

• Clonogenic Assay Integration:

  • Use SNF8 antibodies to analyze protein expression in cells from CFU-Falk phos clonogenic assays

  • Correlate expression levels with differentiation potential and lineage commitment ratios

• Dynamic Expression Analysis During Differentiation:

  • Track SNF8 expression during stem cell differentiation using time-course immunofluorescence

  • Correlate with markers of lineage commitment and differentiation stages

• Mechanistic Studies of ESCRT-II in Stem Cell Function:

  • Investigate SNF8's role in autophagy regulation during stem cell renewal and differentiation

  • Examine SNF8-dependent pathways in progenitor pool maintenance and expansion

What methodological considerations are important when designing antibody panels that include SNF8 for high-dimensional cytometry?

When incorporating SNF8 antibodies into high-dimensional cytometry panels:

• Panel Design Optimization:

  • Conduct preliminary experiments to determine optimal SNF8 antibody concentration and fluorophore brightness

  • Consider spillover and spread when selecting fluorophore conjugates

• Validation in Complex Samples:

  • Follow validation approaches similar to those used for cell surface markers in CyTOF experiments

  • Implement barcoding strategies to minimize batch effects

• Correlation with Transcriptomic Data:

  • Evaluate RNA-protein correlation specifically for SNF8 before panel design

  • Be aware that correlations between RNA and protein expression typically range from 0.38 to 0.58

• Specificity Enhancement Strategies:

  • Incorporate orthogonal data from paired proteomic and RNA analyses

  • Remove markers with low RNA-protein correlation to improve specificity

• Statistical Framework for Analysis:

  • Implement positive predictive value, sensitivity, and specificity metrics for SNF8 detection

  • For high-dimensional analysis, consider computational approaches to identify highly variable markers

What are common pitfalls in SNF8 antibody-based experiments and how can they be avoided?

How can SNF8 antibody validation be integrated into broader reproducibility initiatives in biomedical research?

To enhance reproducibility with SNF8 antibodies:

• Standardized Reporting:

  • Document complete antibody information: catalog number, lot, dilution, incubation conditions

  • Report validation experiments in supplementary materials

  • Include images of full Western blots with molecular weight markers

• Independent Validation:

  • Validate findings with multiple antibodies from different sources

  • Implement orthogonal detection methods (e.g., mass spectrometry)

• Validation Resource Sharing:

  • Contribute validated antibody data to public repositories

  • Share detailed protocols on platforms like protocols.io

• Positive and Negative Controls:

  • Include appropriate controls in every experiment

  • For SNF8 studies, consider using patient-derived cells with SNF8 variants as biological controls

• Integrated Multi-omics Approach:

  • Combine antibody-based detection with RNA-seq or proteomics

  • Apply statistical methods similar to those used in antibody validation studies to assess concordance

How can SNF8 antibodies contribute to understanding autophagy dysfunction in neurological diseases beyond known SNF8-related disorders?

SNF8 antibodies can provide insights into broader neurological conditions:

• Comparative Neuropathology:

  • Use SNF8 antibodies in conjunction with autophagy markers (LC3, LAMP1) to analyze brain tissues from various neurodegenerative conditions

  • Compare findings with those from patients with confirmed SNF8 variants

• Biomarker Development Pipeline:

  • Evaluate SNF8 and ESCRT-II complex expression in accessible patient samples (e.g., fibroblasts, blood cells)

  • Correlate with clinical severity and progression

• Therapeutic Target Identification:

  • Use SNF8 antibodies to screen compound libraries for molecules that modulate SNF8/ESCRT-II levels or function

  • Implement high-content screening with automated image analysis

• Disease Mechanism Exploration:

  • Investigate the relationship between SNF8 and other autophagy-related proteins in neurological conditions

  • Apply proximity ligation assays to detect protein-protein interactions in situ

What role can SNF8 antibodies play in the developing field of single-cell proteomics for neuroscience research?

In single-cell proteomics applications:

• Protocol Optimization for Single-Cell Detection:

  • Adapt standard protocols for enhanced sensitivity in single-cell applications

  • Consider signal amplification methods for low-abundance detection

• Integration with Single-Cell Multi-omics:

  • Combine SNF8 antibody detection with single-cell RNA-seq

  • Develop computational methods to integrate protein and RNA data at single-cell resolution

• Cell Type-Specific Analysis in Brain Tissue:

  • Use SNF8 antibodies in multiplexed immunofluorescence or imaging mass cytometry

  • Correlate SNF8 expression with cell type-specific markers in brain regions affected by neurodevelopmental disorders

• Spatial Transcriptomics Integration:

  • Combine SNF8 antibody staining with spatial transcriptomics

  • Map protein expression patterns in relation to transcriptional signatures in brain tissue

• Validation Strategy Development:

  • Apply similar validation approaches to those used in antibody screening studies

  • Implement statistical methods to assess sensitivity and specificity at the single-cell level