SNRPG Antibody

What is SNRPG and what is its biological function?

SNRPG (small nuclear ribonucleoprotein polypeptide G) is a core component of the spliceosomal U1, U2, U4, and U5 small nuclear ribonucleoproteins (snRNPs), which are fundamental building blocks of the spliceosome. In humans, this canonical protein has 76 amino acid residues and a mass of approximately 8.5 kDa . It plays a critical role in pre-mRNA splicing by forming part of an heptameric protein ring with other Sm proteins (SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF) that assembles on the Sm site of small nuclear RNA to form the core snRNP . Additionally, SNRPG appears to function in the U7 snRNP complex involved in histone 3'-end processing .

Where is SNRPG localized in cells and which tissues express it?

SNRPG exhibits subcellular localization in both the nucleus and cytoplasm, which aligns with its role in RNA processing . It is widely expressed across numerous tissue types in humans. Immunohistochemical studies have shown variable expression levels across tissues, with high expression observed in human epididymis and lower expression in pancreatic tissue . This widespread distribution reflects its essential role in the fundamental cellular process of RNA splicing.

What are common synonyms and alternative designations for SNRPG?

Researchers should be aware of several synonyms when searching literature for SNRPG:

• Sm protein G

• Sm-G

• Small nuclear ribonucleoprotein G

• snRNP-G

• SMG

• PBSCG

The gene ID (NCBI) is 6637, and its UniProt ID is P62308 (Human) .

What types of SNRPG antibodies are available for research applications?

SNRPG antibodies are available in multiple formats with varying specifications:

Polyclonal antibodies offer broader epitope recognition, while monoclonal antibodies provide higher specificity for particular epitopes .

What should researchers consider when selecting an SNRPG antibody for their experiments?

When selecting an SNRPG antibody, researchers should consider:

• Immunogen design: Some antibodies are raised against specific regions of SNRPG (e.g., N-terminal region amino acids 2-36 or the sequence RHVQGILRGFDPFMNLVIDECVEMATSGQQ )

• Species reactivity: Verify cross-reactivity with your model organism (human reactivity is most common, with some antibodies showing mouse and rat reactivity)

• Application compatibility: Ensure the antibody is validated for your specific application (WB, IHC, IF, ELISA)

• Clonality: Consider whether polyclonal (broader epitope recognition) or monoclonal (higher specificity) antibodies better suit your experimental needs

• Validation data: Review the manufacturer's validation images and protocols to ensure the antibody performs as expected in conditions similar to your planned experiments

How can I validate the specificity of an SNRPG antibody?

Antibody validation should follow multiple approaches:

• Western blot analysis: A specific SNRPG antibody should detect a band at approximately 8.5-9 kDa in appropriate cell lysates (e.g., Jurkat, HeLa, MDA-MB-468 cells)

• Orthogonal validation: Compare results with alternative detection methods targeting the same protein

• Positive and negative controls: Include tissues/cells known to express high levels (e.g., epididymis) and low levels (e.g., pancreas) of SNRPG

• Immunofluorescence pattern: Confirm appropriate subcellular localization showing both nuclear and cytoplasmic staining consistent with SNRPG's known distribution

• Knockout validation: When possible, test antibody on SNRPG-knockout samples to confirm specificity

What are the recommended protocols for Western blot analysis using SNRPG antibodies?

For optimal Western blot results with SNRPG antibodies:

• Sample preparation: Prepare cell lysates (e.g., from HeLa or Jurkat cells) using standard lysis buffers containing protease inhibitors

• Gel electrophoresis: Use appropriate percentage gels (12-15% SDS-PAGE) that resolve proteins in the 8-10 kDa range effectively

• Protein loading: Load approximately 35 μg of total protein per lane

• Transfer conditions: Optimize transfer conditions for small proteins (higher methanol percentage, lower voltage, longer transfer time)

• Antibody dilution: Use recommended dilution ratios (typically 1:500-1:1000 for WB)

• Expected results: Detect a band at approximately 9 kDa, which is slightly higher than the calculated molecular weight (8.5 kDa) due to post-translational modifications

What are the optimal conditions for immunohistochemistry with SNRPG antibodies?

For successful immunohistochemistry:

• Tissue preparation: Use formalin-fixed, paraffin-embedded tissues with appropriate antigen retrieval

• Antigen retrieval: For optimal results, use TE buffer pH 9.0 or alternatively, citrate buffer pH 6.0

• Antibody dilution: Use at 1:50-1:500 dilution, depending on the specific antibody and detection system

• Detection system: Use appropriate secondary antibody and visualization system based on host species

• Controls: Include positive control tissues (e.g., human epididymis) and negative control tissues (e.g., human pancreas)

• Expected results: Staining patterns should show both nuclear and cytoplasmic localization in tissues with SNRPG expression

How can I use immunofluorescence to study SNRPG localization?

For immunofluorescence studies:

• Cell preparation: Fix cells (e.g., HeLa) with 4% paraformaldehyde and permeabilize with 0.1% Triton X-100

• Antibody dilution: Use SNRPG antibody at appropriate dilution (e.g., 1:25 for immunofluorescence)

• Secondary antibody: Apply fluorophore-conjugated secondary antibody specific to the host species of your primary antibody (e.g., Dylight® 488-conjugated goat anti-rabbit IgG at 1:200 dilution)

• Counterstaining: Use DAPI for nuclear staining and consider cytoskeletal staining (e.g., Dylight® 554 Phalloidin at 1:100) to visualize cellular structure

• Expected results: Visualization should show primarily cytoplasmic staining in HeLa cells, with some nuclear presence

How does SNRPG relate to autoimmune conditions and what are the research implications?

SNRPG has been identified in research examining molecular mimicry in autoimmune conditions:

• Multiple sclerosis connection: SNRPG is among the proteins identified in studies examining sequence similarities between SARS-CoV-2 nucleocapsid and MS-associated proteins, suggesting potential molecular mimicry mechanisms

• Autoantibody targets: As part of the spliceosomal complex, Sm proteins like SNRPG can become targets for autoantibodies in certain conditions

• Research approach: When studying autoimmune aspects, researchers should:

  • Compare epitope sequences between SNRPG and viral/bacterial proteins

  • Examine antibody cross-reactivity between SNRPG and potential mimetic proteins

  • Consider SNRPG antibody titers in patient populations with relevant autoimmune conditions

How can I study SNRPG's role in spliceosome assembly and function?

To investigate SNRPG's role in splicing:

• Co-immunoprecipitation: Use SNRPG antibodies to pull down spliceosomal complexes and analyze interacting partners

• Proximity ligation assays: Visualize interactions between SNRPG and other spliceosomal components

• RNA immunoprecipitation: Identify RNA species that associate with SNRPG in different cellular contexts

• Knockdown/knockout studies: Use siRNA, shRNA, or CRISPR-Cas9 to deplete SNRPG and examine effects on:

  • Spliceosome assembly

  • Pre-mRNA splicing efficiency

  • Alternative splicing patterns

  • Histone 3'-end processing (given SNRPG's role in U7 snRNP)

What considerations should be made when studying SNRPG across different species?

When conducting cross-species research:

• Sequence conservation: SNRPG is highly conserved across species, with 100% sequence identity between human, mouse, and rat in regions used as immunogens for some antibodies

• Ortholog verification: Confirm ortholog status in your species of interest, as SNRPG orthologs have been reported in mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken

• Antibody cross-reactivity: Verify antibody reactivity with your species of interest through manufacturer data or pilot experiments

• Expression patterns: Compare tissue-specific expression patterns across species to identify potential functional differences

What are common issues with Western blotting using SNRPG antibodies and how can they be resolved?

How can I address challenges in immunohistochemical detection of SNRPG?

For improving IHC results:

• Weak or no signal:

  • Optimize antigen retrieval (try both TE buffer pH 9.0 and citrate buffer pH 6.0)

  • Increase antibody concentration (try 1:50 dilution)

  • Extend primary antibody incubation time or temperature

  • Use signal amplification systems

• High background:

  • Increase blocking time and concentration

  • Reduce primary antibody concentration

  • Include additional washing steps

  • Test alternative blocking reagents

• Inconsistent staining:

  • Standardize fixation protocols

  • Ensure consistent section thickness

  • Use automated staining platforms if available

  • Include positive control tissues with known SNRPG expression patterns

What experimental controls are essential when working with SNRPG antibodies?

Implement these controls for rigorous research:

• Positive controls:

  • Cell lines with confirmed SNRPG expression (Jurkat, HeLa, MDA-MB-468)

  • Tissues with high SNRPG expression (human epididymis)

• Negative controls:

  • Tissues with low SNRPG expression (human pancreas)

  • Primary antibody omission control

  • Isotype control antibody

• Validation controls:

  • Peptide competition assays

  • Multiple antibodies targeting different epitopes

  • SNRPG-depleted samples (siRNA knockdown)

  • Orthogonal detection methods