SNTG1 Antibody

What is SNTG1 and what cellular functions does it perform?

SNTG1 (Syntrophin, gamma 1) is a membrane-associated protein that belongs to the syntrophin family. It has a calculated molecular weight of approximately 58 kDa and consists of 517 amino acids . SNTG1 is encoded by gene ID 54212 and is also known by several alternative names including syntrophin-4, gamma-1-syntrophin, gamma1-syntrophin, and SYN4 . Functionally, SNTG1 is involved in cellular scaffolding and protein interactions within various tissues, particularly in contexts where membrane organization is critical for cellular function.

What types of SNTG1 antibodies are available for research applications?

Several types of SNTG1 antibodies are available for research, varying in host species, clonality, and target epitopes:

What species reactivity can I expect from commercially available SNTG1 antibodies?

Species reactivity varies by antibody. The available SNTG1 antibodies show different reactivity profiles:

• Human-only reactivity: Some antibodies like Proteintech's 20839-1-AP are validated specifically for human samples .

• Multi-species reactivity: Other antibodies show broader reactivity profiles. For example, ABIN6744162 reacts with samples from human, mouse, dog, horse, and bat species . Some antibodies have predicted reactivity with additional species based on sequence homology - for instance, antibodies showing 100% sequence identity with human SNTG1 may cross-react with samples from gorilla, gibbon, monkey, and elephant .

What are the optimal storage conditions for SNTG1 antibodies?

Most SNTG1 antibodies require careful storage to maintain their activity. The recommended storage conditions generally include:

• Short-term storage (up to 1 week): 4°C

• Long-term storage: -20°C, with antibodies typically shipped in buffers containing cryoprotectants like glycerol

• Avoid repeated freeze-thaw cycles as they can degrade antibody performance

• Many SNTG1 antibodies are supplied in PBS buffer with additives such as sodium azide (0.02%) and glycerol (40-50%) at pH 7.2-7.3

How do different epitope-binding regions of SNTG1 antibodies affect experimental outcomes?

The epitope specificity of SNTG1 antibodies significantly impacts experimental outcomes. Antibodies targeting different regions of the SNTG1 protein may yield varying results:

• N-terminal antibodies might detect different SNTG1 isoforms or fragments compared to C-terminal antibodies

• The ABIN6744162 antibody targets amino acids 215-264 , which may recognize specific structural domains within SNTG1

• Full-length recombinant protein immunogens, as used for ABIN2151962 , may provide broader epitope recognition

• The NBP256582 antibody was developed against a specific amino acid sequence (LLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVY), which might target a particular functional domain of SNTG1

Researchers should select antibodies based on the target region that best addresses their experimental questions, considering potential post-translational modifications or protein interactions that might mask certain epitopes.

What are the technical considerations when validating SNTG1 antibodies for novel applications?

When validating SNTG1 antibodies for novel applications, researchers should consider:

• Positive and negative controls: Include tissues or cell lines known to express or lack SNTG1

• Knockdown/knockout validation: When possible, validate specificity using SNTG1 knockdown or knockout samples

• Cross-reactivity testing: Assess potential cross-reactivity with related syntrophin family members

• Validation across multiple applications: Just because an antibody works in WB doesn't guarantee performance in IHC or IF

• Specificity verification: Some antibodies undergo rigorous specificity testing, such as NBP256582, which was verified on protein arrays containing the target protein plus 383 non-specific proteins

• Application-specific optimization: Determine optimal working dilutions experimentally (e.g., 1:500-1:1000 for IHC-P applications with NBP256582 )

How can I optimize Western blotting conditions for detecting low abundance SNTG1 in various tissue samples?

Optimizing Western blotting for low-abundance SNTG1 detection requires several considerations:

• Protein extraction optimization:

  • Use specialized extraction buffers for membrane-associated proteins

  • Consider subcellular fractionation to enrich membrane fractions

• Antibody selection and concentration:

  • Select antibodies validated for WB applications (e.g., ABIN6744162 at 0.2-1 μg/mL concentration range )

  • Optimize primary antibody concentration through titration experiments

• Detection system enhancement:

  • Employ high-sensitivity chemiluminescent substrates

  • Consider signal amplification systems for very low abundance proteins

  • Extend exposure times while monitoring background

• Sample loading optimization:

  • Increase total protein loading (while monitoring for background)

  • Use concentrated protein samples when possible

• Blocking and washing optimization:

  • Test different blocking agents (BSA vs. milk proteins)

  • Optimize washing steps to reduce background while preserving signal

What are the challenges of multiplex immunofluorescence experiments involving SNTG1 antibodies?

Multiplex immunofluorescence with SNTG1 antibodies presents several challenges:

• Primary antibody compatibility: When using multiple primary antibodies, they must be from different host species or use isotype-specific secondary antibodies if from the same host

• Epitope accessibility: When examining SNTG1 alongside other proteins, antigen retrieval methods must be compatible for all targets

• Signal separation: Ensure fluorophores have distinct emission spectra with minimal overlap to prevent bleed-through

• Antibody validation: Unconjugated SNTG1 antibodies like ABIN2151962 must be tested for compatibility with your secondary antibody system

• Signal-to-noise optimization: SNTG1's membrane localization may require specialized image acquisition settings compared to cytoplasmic proteins

• Sequential staining considerations: Some multiplex protocols require sequential rather than simultaneous antibody application, which may affect epitope availability

What control samples should be included when using SNTG1 antibodies in immunohistochemistry?

When performing immunohistochemistry with SNTG1 antibodies like NBP256582 , include these controls:

• Positive tissue controls: Samples known to express SNTG1

• Negative tissue controls: Samples known to lack SNTG1 expression

• No primary antibody control: To assess secondary antibody background

• Isotype control: Using matched IgG (e.g., rabbit IgG for rabbit polyclonal antibodies) at equivalent concentrations

• Absorption control: Pre-incubating the antibody with the immunogen peptide used to generate it

• Dilution series: Testing a range around the recommended 1:500-1:1000 dilution

• Multiple antibody validation: Using two different SNTG1 antibodies targeting different epitopes

These controls help distinguish true SNTG1 staining from technical artifacts and provide confidence in experimental results.

How should I determine the optimal working dilution for a new SNTG1 antibody?

Determining optimal working dilution for a new SNTG1 antibody requires systematic testing:

• Start with manufacturer recommendations:

  • For IHC-P applications with NBP256582, begin with the suggested 1:500-1:1000 range

  • For WB applications with ABIN6744162, start with 0.2-1 μg/mL range

• Create a dilution series:

  • Test 2-fold or 5-fold dilution series above and below recommended concentration

  • For polyclonal antibodies, wider titration ranges may be necessary

• Evaluate signal-to-noise ratio:

  • Assess specific staining intensity versus background

  • Document results systematically with standardized imaging parameters

• Consider application-specific factors:

  • Different applications (WB, IHC, IF, ELISA) typically require different dilutions

  • Tissue type may affect optimal dilution (fixed vs. frozen, human vs. animal)

• Validate reproducibility:

  • Test optimal dilution across multiple samples

  • Ensure consistent performance across different lots when possible

What fixation and antigen retrieval methods work best for SNTG1 detection in tissue sections?

For optimal SNTG1 detection in tissue sections using antibodies like NBP256582 :

• Fixation recommendations:

  • Standard 10% neutral buffered formalin is typically compatible

  • Fixation time should be optimized (typically 24-48 hours)

  • Consider testing alternative fixatives for specialized applications

• Antigen retrieval optimization:

  • Heat-induced epitope retrieval (HIER) methods:

    • Citrate buffer (pH 6.0)

    • EDTA buffer (pH 9.0)

    • Test both to determine which works best for your specific SNTG1 antibody

  • Enzymatic retrieval methods:

    • Proteinase K digestion (as an alternative if HIER is unsuccessful)

    • Trypsin digestion

• Section thickness considerations:

  • 4-5 μm sections typically provide optimal results

  • Thicker sections may require adjusted antibody concentrations and incubation times

• Time and temperature parameters:

  • HIER duration typically 15-20 minutes at full pressure/temperature

  • Allow for adequate cooling time before antibody application

What are the key considerations when developing a sandwich ELISA assay for SNTG1 quantification?

Developing a sandwich ELISA for SNTG1 quantification requires careful planning:

• Antibody pair selection:

  • Select two antibodies recognizing different epitopes

  • Consider using antibodies like Proteintech's 20839-1-AP (validated for ELISA) as capture or detection antibody

  • The second antibody should target a non-overlapping epitope

• Assay optimization:

  • Determine optimal coating concentration for capture antibody

  • Optimize detection antibody concentration

  • Establish standard curve using recombinant SNTG1 protein

  • Determine appropriate sample dilutions

• Specificity considerations:

  • Validate against samples with varying SNTG1 expression levels

  • Include negative controls lacking SNTG1

  • Test for cross-reactivity with related proteins

• Technical parameters:

  • Optimize blocking buffer composition (BSA vs. casein)

  • Determine optimal incubation times and temperatures

  • Establish washing protocol to minimize background

• Validation studies:

  • Assess precision (intra- and inter-assay variability)

  • Determine analytical sensitivity (lower limit of detection)

  • Evaluate recovery in spiked samples

What are common causes of non-specific binding when using SNTG1 antibodies, and how can they be addressed?

Non-specific binding with SNTG1 antibodies can result from several factors:

• Antibody-related factors:

  • Polyclonal antibodies (like many SNTG1 antibodies) may contain non-specific immunoglobulins

  • Solution: Use affinity-purified antibodies like NBP256582 that undergo additional purification steps

• Protocol optimization:

  • Insufficient blocking: Increase blocking time or try alternative blocking agents

  • Inadequate washing: Extend wash steps or add mild detergents to wash buffers

  • High antibody concentration: Titrate to find minimal effective concentration

• Sample-related factors:

  • Endogenous enzymes: Add peroxidase blocking step for IHC applications

  • Endogenous biotin: Include avidin/biotin blocking for biotin-based detection systems

  • Protein-protein interactions: Consider crosslinking fixation or denaturing conditions

• Detection system considerations:

  • Secondary antibody cross-reactivity: Use highly cross-adsorbed secondary antibodies

  • Amplification system background: Reduce amplification reagent concentration

• Validation approaches:

  • Use antibodies verified on protein arrays (like NBP256582 ) which have been tested against 383+ non-specific proteins

  • Include peptide competition controls to confirm specificity

How should discrepancies in SNTG1 detection between different antibodies be interpreted and resolved?

When facing discrepancies between different SNTG1 antibodies:

• Analyze epitope differences:

  • Compare target regions of each antibody (N-terminal, C-terminal, internal domains)

  • Antibodies targeting different regions may detect different isoforms or post-translationally modified forms

  • Document which specific amino acid sequences or regions each antibody recognizes

• Consider technical variables:

  • Application-specific performance: Some antibodies work better in certain applications

  • Sample preparation differences: Fixation, extraction methods, and buffers affect epitope availability

  • Detection systems: Sensitivity differences between visualization methods

• Resolution strategies:

  • Perform knockout/knockdown validation to confirm specificity

  • Use orthogonal techniques (mRNA analysis, mass spectrometry) to confirm protein identity

  • Test multiple antibodies targeting different epitopes on the same samples

  • Consider epitope mapping to precisely identify binding regions

• Data interpretation:

  • Document all experimental conditions precisely

  • Consider publishing conflicting results to advance field knowledge

  • Validate key findings with at least two independent antibodies

What strategies can be employed to quantify relative SNTG1 expression levels across different tissue samples?

For quantifying relative SNTG1 expression across tissues:

• Western blot quantification:

  • Use antibodies validated for Western blotting like ABIN6744162 or ABIN2151962

  • Normalize to loading controls appropriate for your experimental context

  • Use digital imaging and analysis software for densitometry

  • Run standard curves with recombinant SNTG1 when possible

• Immunohistochemistry quantification:

  • Employ digital pathology systems for unbiased quantification

  • Use NBP256582 at standardized dilutions across all samples

  • Develop scoring systems based on staining intensity and distribution

  • Include reference standards on each slide for normalization

• Flow cytometry approaches:

  • Optimize cell permeabilization for this membrane-associated protein

  • Use fluorophore-conjugated antibodies or validated secondary detection systems

  • Establish gating strategies based on negative controls

  • Express results as median fluorescence intensity

• qPCR correlation:

  • Complement protein detection with mRNA quantification

  • Assess correlation between protein and transcript levels

  • Design primers spanning exon-exon junctions for specificity

• Multiplexed approaches:

  • Consider multiplexed detection with normalization proteins

  • Use orthogonal methods to validate key findings

How can phosphorylation or other post-translational modifications of SNTG1 affect antibody binding and experimental outcomes?

Post-translational modifications (PTMs) of SNTG1 can significantly impact antibody binding:

• Phosphorylation effects:

  • Epitopes containing phosphorylation sites may show altered antibody recognition

  • Phosphorylation-specific antibodies may be needed to study specific signaling states

  • Consider phosphatase treatment of samples to determine if phosphorylation affects detection

• Other relevant PTMs:

  • Glycosylation may mask epitopes in native protein

  • Ubiquitination might generate additional bands in Western blots

  • Proteolytic processing could create fragments recognized differently by various antibodies

• Experimental design considerations:

  • Include phosphatase inhibitors in lysis buffers if studying phosphorylated forms

  • Consider native versus denaturing conditions for detection

  • Compare reducing and non-reducing conditions for disulfide-dependent epitopes

• Validation approaches:

  • Use multiple antibodies targeting different regions

  • Employ phosphorylation-specific or PTM-specific antibodies when available

  • Consider mass spectrometry to identify and map PTMs

What are the considerations for using SNTG1 antibodies in proximity ligation assays to study protein-protein interactions?

When using SNTG1 antibodies in proximity ligation assays (PLA):

• Antibody pair selection:

  • Select antibodies from different host species (e.g., rabbit polyclonal and mouse monoclonal)

  • Consider using ABIN2151962 (mouse monoclonal) paired with a rabbit antibody

  • Ensure both antibodies can simultaneously access their epitopes

• Specificity considerations:

  • Validate each antibody individually before combining in PLA

  • Include all necessary controls (primary antibody omission, non-interacting protein pairs)

  • Consider peptide competition controls to confirm specificity

• Sample preparation optimization:

  • Optimize fixation for epitope preservation

  • Determine optimal permeabilization conditions

  • Test various blocking reagents to minimize background

• Technical considerations:

  • Determine optimal antibody concentrations (often lower than for standard applications)

  • Optimize incubation times and temperatures

  • Include appropriate positive and negative interaction controls

• Data analysis approach:

  • Establish quantification methods for PLA signals

  • Consider co-localization analysis with subcellular markers

  • Statistical analysis of signal distribution and intensity

How can SNTG1 antibodies be utilized in ChIP-seq experiments to study potential transcriptional regulatory functions?

For ChIP-seq applications with SNTG1 antibodies:

• Antibody selection criteria:

  • Choose highly specific antibodies validated for immunoprecipitation

  • Consider antibodies that have been rigorously tested for specificity, like NBP256582

  • Test multiple antibodies targeting different epitopes

• Experimental design considerations:

  • Optimize crosslinking conditions for protein-DNA interactions

  • Determine optimal sonication parameters for chromatin fragmentation

  • Include appropriate controls (input, IgG control, positive control protein)

• Validation strategies:

  • Perform ChIP-qPCR validation at known or predicted binding sites

  • Include spike-in controls for normalization

  • Compare binding patterns with other DNA-binding proteins or histone marks

• Data analysis approach:

  • Apply appropriate peak calling algorithms

  • Perform motif analysis on identified binding regions

  • Correlate binding sites with gene expression data

  • Conduct pathway analysis of genes associated with binding sites

• Functional validation:

  • Integrate ChIP-seq data with other genomic datasets

  • Validate key findings with orthogonal methods

  • Consider perturbation experiments to confirm functional significance

What considerations are important when developing SNTG1 antibodies for super-resolution microscopy studies?

For super-resolution microscopy with SNTG1 antibodies:

• Antibody selection:

  • Choose antibodies with demonstrated high specificity

  • Consider antibodies validated for immunofluorescence like ABIN2151962

  • Monoclonal antibodies often provide more consistent results

• Labeling strategies:

  • Direct fluorophore conjugation versus secondary detection systems

  • Consider small molecule tags (SNAP, CLIP, Halo) for live-cell applications

  • Evaluate quantum dots or other photostable fluorophores for extended imaging

• Sample preparation optimization:

  • Optimize fixation for epitope preservation and ultrastructure

  • Consider expansion microscopy protocols for improved resolution

  • Test clearing techniques for thick tissue sections

• Technical considerations:

  • Minimize distance between fluorophore and target (direct conjugation, Fab fragments)

  • Optimize labeling density for particular super-resolution techniques

  • Consider multicolor approaches to study protein interactions

• Validation approaches:

  • Compare with conventional microscopy and other techniques

  • Include appropriate controls (knockout/knockdown, competing peptide)

  • Consider correlative electron microscopy for ultrastructural context

How might new technologies improve SNTG1 antibody development and validation for challenging applications?

Emerging technologies poised to enhance SNTG1 antibody development include:

• Advanced antibody engineering:

  • Recombinant antibody technology for enhanced reproducibility

  • Single-domain antibodies (nanobodies) for improved access to sterically hindered epitopes

  • Site-specific conjugation strategies for optimal fluorophore positioning

• Improved validation approaches:

  • CRISPR/Cas9 knockout validation systems

  • Automated high-throughput specificity screening platforms

  • Tissue and cell microarrays for rapid cross-reactivity testing

• Enhanced production methods:

  • Cell-free expression systems for difficult antigens

  • Directed evolution for affinity and specificity optimization

  • Computational design of optimal immunogens

• Novel detection technologies:

  • DNA-barcoded antibodies for ultra-multiplexed detection

  • Advanced biosensors for real-time protein monitoring

  • Aptamer-antibody hybrid detection systems

• Artificial intelligence applications:

  • Machine learning algorithms for epitope prediction

  • Automated image analysis for validation

  • Structure-based antibody design and optimization

What are the current limitations in studying SNTG1 using antibody-based approaches, and how might they be overcome?

Current limitations in SNTG1 antibody-based research include:

• Isoform specificity challenges:

  • Syntrophin family members share homology

  • Current solution: Careful epitope selection and validation against related proteins

  • Future direction: Development of isoform-specific antibodies targeting unique regions

• Post-translational modification detection:

  • Limited availability of modification-specific antibodies

  • Current solution: Combinations of immunoprecipitation and mass spectrometry

  • Future direction: Development of site-specific phospho-antibodies and other PTM-specific reagents

• Temporal dynamics studies:

  • Antibodies provide static snapshots rather than dynamic information

  • Current solution: Time-course experiments with multiple samples

  • Future direction: Integration with biosensor technologies for real-time monitoring

• Tissue penetration limitations:

  • Full-size antibodies have limited penetration in thick tissues

  • Current solution: Tissue sectioning or clearing techniques

  • Future direction: Development of smaller binding proteins with improved tissue penetration

• Quantification challenges:

  • Semi-quantitative nature of many antibody-based techniques

  • Current solution: Careful controls and standard curves

  • Future direction: Advanced quantitative imaging and analysis methods