SPNS2 (Spinster homolog 2) is a sphingolipid transporter critical for sphingosine-1-phosphate (S1P) signaling, which regulates cardiovascular, immunological, and neural functions . The SPNS2 Antibody - N-terminal region : FITC (ARP56057_P050-FITC) is a polyclonal antibody developed against a synthetic peptide from the N-terminal region of human SPNS2 .
Host Species: Rabbit
Conjugation: Fluorescein Isothiocyanate (FITC)
Applications: Western blotting (WB)
Reactivities: Human, Mouse, Rat, Pig, Rabbit (predicted homology)
Immunogen: Synthetic peptide sequence: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
SPNS2 mediates S1P export, essential for myocardial precursor migration and immune cell trafficking .
Western Blot: Detects a ~60 kDa band corresponding to SPNS2 in human cell lines (e.g., RT-4, U-251 MG) and tissues (liver, tonsil) .
Blocking Peptide: Catalog # AAP56057 (validated for competition assays) .
| Parameter | Detail |
|---|---|
| Molecular Weight | 60 kDa (UniProt: Q8IVW8) |
| Gene ID | 124976 (NCBI) |
| Epitope Location | N-terminal region |
While not directly related to SPX2/SPNS2, SPACE2 (Structural Profiling of Antibody Cluster Epitopes) is highlighted as a computational tool for epitope profiling. It clusters antibodies based on structural binding poses, achieving higher resolution than sequence-based methods .
SPACE2 separates antibodies binding to the same epitope but in different poses .
Example: Anti-lysozyme antibodies were clustered into eight groups with 100% epitope consistency .
SARS-CoV-2 mAbs: CT-P59 (targets RBD) and 4-8 (targets NTD) show high neutralization potency (IC50 ≤ 0.009 µg/ml) .
Cross-Reactive mAbs: B-S2-mAb-2 neutralizes SARS-CoV-2 variants by targeting the S2 subunit epitope 1146–1152 (DSFKEEL) .
No sources directly address "SPX2 Antibody"; available data focus on SPNS2 or unrelated targets.
SPX2 in plants (e.g., rice) refers to a phosphate regulatory protein, not an antibody .
SPNS2 (Sphingolipid transporter 2) is a protein involved in sphingolipid transport with a molecular mass of approximately 58 kilodaltons. It may also be known by alternative names including DFNB115, SLC62A2, protein spinster homolog 2, and SPNS sphingolipid transporter 2. This protein has gained research interest due to its role in sphingolipid metabolism and potential implications in various physiological and pathological processes. Researchers studying membrane transport, lipid metabolism, or related signaling pathways would benefit from utilizing SPNS2 antibodies in their experimental approaches .
Multiple SPNS2 antibodies are available for research applications, including both polyclonal and monoclonal varieties. These antibodies target different epitopes of the SPNS2 protein, such as N-terminal regions or specific amino acid sequences (e.g., aa 482-499). The antibodies are produced in various host species and demonstrate different reactivity profiles across species including human, mouse, rat, rabbit, and other organisms. The selection of an appropriate antibody should be guided by the specific experimental requirements, target species, and intended application .
SPNS2 antibodies can be employed in multiple research applications including:
Western blotting (WB) for protein detection and quantification
Enzyme-linked immunosorbent assay (ELISA) for protein quantification
Immunohistochemistry (IHC) for tissue localization studies
Immunoprecipitation (IP) for protein isolation and interaction studies
Immunofluorescence (IF) for subcellular localization
Each application requires specific optimization and validation steps to ensure reliable results. The choice of antibody should be guided by its demonstrated performance in the intended application, as different antibodies may excel in certain applications while performing poorly in others .
Validation of SPNS2 antibody specificity requires a multi-faceted approach:
Genetic controls: Use SPNS2 knockdown or knockout systems (e.g., siRNA-mediated knockdown or Sphk2^-/-^ MEFs) to verify antibody specificity.
Isotype controls: Implement IgG isotype control antibodies to identify non-specific binding.
Secondary antibody controls: Omit primary antibodies to assess background fluorescence from secondary antibodies alone.
Cross-reactivity testing: Test antibodies against related proteins to ensure target specificity.
Multiple antibody comparison: Compare results from different antibodies targeting distinct epitopes of the same protein.
This comprehensive validation approach increases confidence in experimental findings and helps identify potential artifacts or non-specific reactions .
For optimal Western blotting results with SPNS2 antibodies:
Sample preparation: Mix protein samples with 5× Laemmli sample buffer and boil at 100°C for 5 minutes.
Gel selection: Separate proteins on gradient gels (e.g., 4-12% Bis-Tris) for optimal resolution.
Transfer conditions: Transfer to nitrocellulose membrane at approximately 400 mA for 1 hour.
Blocking: Block membranes with 5% skim milk in PBS containing 0.1% Triton X-100 (PBS-T) for 1 hour at room temperature.
Primary antibody: Dilute antibodies to appropriate concentration (e.g., 1:1,000 for commercial antibodies, approximately 0.7-1 µg/ml) in appropriate diluent.
Incubation: Incubate with primary antibody overnight at 4°C with gentle rocking.
Controls: Include loading controls (e.g., α-tubulin antibody at 1:5,000).
These conditions provide a starting point but may require optimization based on specific experimental goals and antibody properties .
For effective immunoprecipitation with SPNS2 antibodies:
Antibody amount: Use approximately 4 μg of antibody per immunoprecipitation reaction.
Magnetic beads: Combine with 50 μl each of Protein A and G magnetic beads.
Incubation: Add antibody and beads to cell lysate, mix gently, and incubate on ice for 30 minutes.
Column preparation: Place magnetic columns on a magnetic stand and equilibrate with appropriate buffer.
Washing: Perform multiple washes (4-5 times) with equilibration buffer followed by a low salt wash.
Elution: Elute immunoprecipitates with hot Laemmli sample buffer.
Analysis: Analyze by SDS-PAGE and immunoblotting according to standard protocols.
Including appropriate controls, particularly IgG isotype controls, is essential to account for non-specific binding .
Performance comparisons between commercial SPNS2 antibodies reveal application-specific strengths:
| Antibody Source | Western Blot | Immunoprecipitation | Immunofluorescence | Species Reactivity |
|---|---|---|---|---|
| Proteintech | Superior sensitivity and selectivity | Moderate performance | Less optimal | Human cell lines |
| ECM Biosciences | Moderate performance | Superior performance | Superior performance | Human cell lines |
Both antibodies demonstrated non-specific interactions in mouse embryonic fibroblasts (MEFs) that were not observed in human cell lines. This highlights the importance of species-specific validation and suggests that researchers should select antibodies based on their intended application rather than assuming equal performance across all methodologies .
For targeting specific epitopes within disordered regions of proteins like SPNS2:
Complementary peptide identification: Identify peptide sequences complementary to the target disordered region.
Antibody scaffold selection: Choose a stable antibody scaffold tolerant to peptide grafting, such as a human heavy chain variable (VH) domain stable without a light chain partner.
CDR loop grafting: Graft the complementary peptide onto the CDR (particularly CDR3) loop of the antibody scaffold.
Expression and purification: Express the designed antibody in bacterial systems and purify using chromatography.
Structural validation: Confirm structural integrity using techniques like circular dichroism spectroscopy.
Binding validation: Verify binding specificity and affinity using ELISA and other binding assays.
This rational design approach enables targeting specific epitopes within disordered protein regions with high specificity and has been successful for proteins involved in neurodegenerative disorders .
To address cross-reactivity issues:
Pre-adsorption testing: Incubate antibodies with purified target protein before application to determine if binding is eliminated.
Peptide competition assays: Perform antibody binding in the presence of increasing concentrations of target peptide to demonstrate specific binding.
Multiple antibody approach: Use multiple antibodies targeting different epitopes of the same protein to confirm results.
Orthogonal methods: Validate findings using non-antibody-based methods (e.g., mass spectrometry).
Genetic models: Verify specificity using genetic knockout or knockdown models where the target protein is absent or significantly reduced.
Species-specific validation: Thoroughly validate antibodies when transitioning between species, as cross-reactivity patterns can differ significantly.
This multi-faceted approach helps distinguish specific signal from non-specific interactions and increases confidence in experimental results .
Standardization of SPNS2 antibody data requires:
Reference standards: Include standard positive and negative controls in each experiment.
Normalization protocols: Normalize signals to appropriate housekeeping proteins or total protein staining.
Quantification methods: Use consistent quantification methodologies across experiments (e.g., integrated density measurements for Western blots).
Metadata documentation: Record detailed metadata including antibody lot numbers, dilutions, and incubation conditions.
Statistical analysis: Apply appropriate statistical tests based on data distribution and experimental design.
\text{Normalized SPNS2 Signal} = \frac{\text{SPNS2 Signal Intensity}}{\text{Reference Protein Signal Intensity}}
This standardization enables meaningful comparisons between experiments and laboratories while minimizing technical variability .
In translational research contexts:
Anti-drug antibody (ADA) monitoring: Implement multi-tiered testing schemes including screening, confirmation, and neutralization assays.
Classification of antibody responses: Distinguish between non-neutralizing antibodies (non-NAbs) and neutralizing antibodies (NAbs).
Pharmacokinetic/pharmacodynamic (PK/PD) impact: Assess how antibody responses affect therapeutic pharmacokinetics and pharmacodynamics.
Safety implications: Monitor for adverse events associated with immunogenicity.
Data mapping: Structure immunogenicity data according to CDISC standards (e.g., Immunogenicity Specimen Assessments domain).
These considerations are critical for translational studies involving therapeutic antibodies, as immune responses can significantly affect safety, efficacy, and durability of treatment effects .
Integration of antibody-based data with -omics approaches:
Correlation analysis: Correlate protein expression data from antibody-based methods with transcriptomic data.
Network analysis: Place SPNS2 in biological networks using protein-protein interaction data combined with antibody-based co-immunoprecipitation data.
Functional validation: Use antibodies to validate findings from genomic or proteomic screens through targeted interventions.
Multi-omics platforms: Implement platforms that allow simultaneous analysis of proteins, metabolites, and transcripts.
Data visualization: Develop visualization tools that integrate multiple data types to identify patterns and relationships.
This integrated approach provides a more comprehensive understanding of SPNS2 function and places antibody-derived data in broader biological context.
Common causes of false results include:
| Issue | Potential Causes | Solutions |
|---|---|---|
| False positives | Cross-reactivity with similar proteins | Use highly specific antibodies validated against knockout controls |
| Non-specific binding to other cellular components | Optimize blocking conditions and washing steps | |
| Secondary antibody cross-reactivity | Use species-appropriate secondary antibodies | |
| False negatives | Epitope masking by protein-protein interactions | Try multiple antibodies targeting different epitopes |
| Low expression levels | Increase protein loading or use more sensitive detection methods | |
| Protein degradation | Include protease inhibitors and maintain appropriate sample conditions | |
| Ineffective antibody concentration | Titrate antibody to determine optimal concentration |
Implementing appropriate controls and validating with multiple methods helps identify and address these issues .
For challenging detection scenarios:
Antigen retrieval optimization: Test multiple antigen retrieval methods (heat-induced, enzymatic, pH variations) to maximize epitope accessibility.
Signal amplification: Employ tyramide signal amplification or other amplification methods for low-abundance targets.
Subcellular fractionation: Enrich for specific compartments before analysis to increase signal-to-noise ratio.
Fixation optimization: Test multiple fixation protocols to preserve both structure and antigenicity.
Confocal microscopy: Use high-resolution imaging to precisely localize subcellular signals.
Super-resolution techniques: Implement STORM, PALM, or other super-resolution approaches for detailed localization studies.
Multi-label approaches: Combine SPNS2 antibodies with markers for specific organelles or structures to improve interpretation.
These approaches help overcome limitations in detecting SPNS2 in challenging contexts where standard protocols may be insufficient.