SPX2 Antibody

Shipped with Ice Packs
In Stock

Description

SPNS2 Antibody Overview

SPNS2 (Spinster homolog 2) is a sphingolipid transporter critical for sphingosine-1-phosphate (S1P) signaling, which regulates cardiovascular, immunological, and neural functions . The SPNS2 Antibody - N-terminal region : FITC (ARP56057_P050-FITC) is a polyclonal antibody developed against a synthetic peptide from the N-terminal region of human SPNS2 .

Key Features:

  • Host Species: Rabbit

  • Conjugation: Fluorescein Isothiocyanate (FITC)

  • Applications: Western blotting (WB)

  • Reactivities: Human, Mouse, Rat, Pig, Rabbit (predicted homology)

  • Immunogen: Synthetic peptide sequence: PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY

Target Function

SPNS2 mediates S1P export, essential for myocardial precursor migration and immune cell trafficking .

Antibody Performance

  • Western Blot: Detects a ~60 kDa band corresponding to SPNS2 in human cell lines (e.g., RT-4, U-251 MG) and tissues (liver, tonsil) .

  • Blocking Peptide: Catalog # AAP56057 (validated for competition assays) .

ParameterDetail
Molecular Weight60 kDa (UniProt: Q8IVW8)
Gene ID124976 (NCBI)
Epitope LocationN-terminal region

Comparative Analysis of Antibody Clustering Tools

While not directly related to SPX2/SPNS2, SPACE2 (Structural Profiling of Antibody Cluster Epitopes) is highlighted as a computational tool for epitope profiling. It clusters antibodies based on structural binding poses, achieving higher resolution than sequence-based methods .

Key Findings:

  • SPACE2 separates antibodies binding to the same epitope but in different poses .

  • Example: Anti-lysozyme antibodies were clustered into eight groups with 100% epitope consistency .

Neutralizing Antibodies (Non-SPX2 Examples)

  • SARS-CoV-2 mAbs: CT-P59 (targets RBD) and 4-8 (targets NTD) show high neutralization potency (IC50 ≤ 0.009 µg/ml) .

  • Cross-Reactive mAbs: B-S2-mAb-2 neutralizes SARS-CoV-2 variants by targeting the S2 subunit epitope 1146–1152 (DSFKEEL) .

SPHK2 (D2V3G) Rabbit mAb #32346

  • Target: Sphingosine kinase 2 (SPHK2)

  • Applications: IP, WB

  • Host: Rabbit IgG

  • Reactivity: Human .

Critical Limitations

  • No sources directly address "SPX2 Antibody"; available data focus on SPNS2 or unrelated targets.

  • SPX2 in plants (e.g., rice) refers to a phosphate regulatory protein, not an antibody .

Recommendations for Further Research

  1. Verify if SPX2 is a typographical error for SPNS2 or another target.

  2. Explore structural epitope profiling tools like SPACE2 for antibody validation .

  3. Consult additional databases (e.g., UniProt, NCBI) for SPX2-associated antibodies outside the provided sources.

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Composition: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
SPX2 antibody; At2g26660 antibody; F18A8.3 antibody; SPX domain-containing protein 2 antibody; Protein SPX DOMAIN GENE 2 antibody; AtSPX2 antibody
Target Names
SPX2
Uniprot No.

Target Background

Function
This antibody may inhibit PHR1 DNA-binding activity in a phosphate-dependent manner.
Database Links

KEGG: ath:AT2G26660

STRING: 3702.AT2G26660.1

UniGene: At.38863

Subcellular Location
Nucleus.

Q&A

What is SPNS2 and why is it of interest to researchers?

SPNS2 (Sphingolipid transporter 2) is a protein involved in sphingolipid transport with a molecular mass of approximately 58 kilodaltons. It may also be known by alternative names including DFNB115, SLC62A2, protein spinster homolog 2, and SPNS sphingolipid transporter 2. This protein has gained research interest due to its role in sphingolipid metabolism and potential implications in various physiological and pathological processes. Researchers studying membrane transport, lipid metabolism, or related signaling pathways would benefit from utilizing SPNS2 antibodies in their experimental approaches .

What types of SPNS2 antibodies are available for research applications?

Multiple SPNS2 antibodies are available for research applications, including both polyclonal and monoclonal varieties. These antibodies target different epitopes of the SPNS2 protein, such as N-terminal regions or specific amino acid sequences (e.g., aa 482-499). The antibodies are produced in various host species and demonstrate different reactivity profiles across species including human, mouse, rat, rabbit, and other organisms. The selection of an appropriate antibody should be guided by the specific experimental requirements, target species, and intended application .

What are the primary research applications for SPNS2 antibodies?

SPNS2 antibodies can be employed in multiple research applications including:

  • Western blotting (WB) for protein detection and quantification

  • Enzyme-linked immunosorbent assay (ELISA) for protein quantification

  • Immunohistochemistry (IHC) for tissue localization studies

  • Immunoprecipitation (IP) for protein isolation and interaction studies

  • Immunofluorescence (IF) for subcellular localization

Each application requires specific optimization and validation steps to ensure reliable results. The choice of antibody should be guided by its demonstrated performance in the intended application, as different antibodies may excel in certain applications while performing poorly in others .

How should researchers validate the specificity of SPNS2 antibodies?

Validation of SPNS2 antibody specificity requires a multi-faceted approach:

  • Genetic controls: Use SPNS2 knockdown or knockout systems (e.g., siRNA-mediated knockdown or Sphk2^-/-^ MEFs) to verify antibody specificity.

  • Isotype controls: Implement IgG isotype control antibodies to identify non-specific binding.

  • Secondary antibody controls: Omit primary antibodies to assess background fluorescence from secondary antibodies alone.

  • Cross-reactivity testing: Test antibodies against related proteins to ensure target specificity.

  • Multiple antibody comparison: Compare results from different antibodies targeting distinct epitopes of the same protein.

This comprehensive validation approach increases confidence in experimental findings and helps identify potential artifacts or non-specific reactions .

What are the optimal conditions for using SPNS2 antibodies in Western blotting?

For optimal Western blotting results with SPNS2 antibodies:

  • Sample preparation: Mix protein samples with 5× Laemmli sample buffer and boil at 100°C for 5 minutes.

  • Gel selection: Separate proteins on gradient gels (e.g., 4-12% Bis-Tris) for optimal resolution.

  • Transfer conditions: Transfer to nitrocellulose membrane at approximately 400 mA for 1 hour.

  • Blocking: Block membranes with 5% skim milk in PBS containing 0.1% Triton X-100 (PBS-T) for 1 hour at room temperature.

  • Primary antibody: Dilute antibodies to appropriate concentration (e.g., 1:1,000 for commercial antibodies, approximately 0.7-1 µg/ml) in appropriate diluent.

  • Incubation: Incubate with primary antibody overnight at 4°C with gentle rocking.

  • Controls: Include loading controls (e.g., α-tubulin antibody at 1:5,000).

These conditions provide a starting point but may require optimization based on specific experimental goals and antibody properties .

What protocol is recommended for immunoprecipitation with SPNS2 antibodies?

For effective immunoprecipitation with SPNS2 antibodies:

  • Antibody amount: Use approximately 4 μg of antibody per immunoprecipitation reaction.

  • Magnetic beads: Combine with 50 μl each of Protein A and G magnetic beads.

  • Incubation: Add antibody and beads to cell lysate, mix gently, and incubate on ice for 30 minutes.

  • Column preparation: Place magnetic columns on a magnetic stand and equilibrate with appropriate buffer.

  • Washing: Perform multiple washes (4-5 times) with equilibration buffer followed by a low salt wash.

  • Elution: Elute immunoprecipitates with hot Laemmli sample buffer.

  • Analysis: Analyze by SDS-PAGE and immunoblotting according to standard protocols.

Including appropriate controls, particularly IgG isotype controls, is essential to account for non-specific binding .

How do different commercial SPNS2 antibodies compare in performance across applications?

Performance comparisons between commercial SPNS2 antibodies reveal application-specific strengths:

Antibody SourceWestern BlotImmunoprecipitationImmunofluorescenceSpecies Reactivity
ProteintechSuperior sensitivity and selectivityModerate performanceLess optimalHuman cell lines
ECM BiosciencesModerate performanceSuperior performanceSuperior performanceHuman cell lines

Both antibodies demonstrated non-specific interactions in mouse embryonic fibroblasts (MEFs) that were not observed in human cell lines. This highlights the importance of species-specific validation and suggests that researchers should select antibodies based on their intended application rather than assuming equal performance across all methodologies .

What strategies exist for developing antibodies targeting specific epitopes within disordered regions of SPNS2?

For targeting specific epitopes within disordered regions of proteins like SPNS2:

  • Complementary peptide identification: Identify peptide sequences complementary to the target disordered region.

  • Antibody scaffold selection: Choose a stable antibody scaffold tolerant to peptide grafting, such as a human heavy chain variable (VH) domain stable without a light chain partner.

  • CDR loop grafting: Graft the complementary peptide onto the CDR (particularly CDR3) loop of the antibody scaffold.

  • Expression and purification: Express the designed antibody in bacterial systems and purify using chromatography.

  • Structural validation: Confirm structural integrity using techniques like circular dichroism spectroscopy.

  • Binding validation: Verify binding specificity and affinity using ELISA and other binding assays.

This rational design approach enables targeting specific epitopes within disordered protein regions with high specificity and has been successful for proteins involved in neurodegenerative disorders .

How can researchers address cross-reactivity issues with SPNS2 antibodies?

To address cross-reactivity issues:

  • Pre-adsorption testing: Incubate antibodies with purified target protein before application to determine if binding is eliminated.

  • Peptide competition assays: Perform antibody binding in the presence of increasing concentrations of target peptide to demonstrate specific binding.

  • Multiple antibody approach: Use multiple antibodies targeting different epitopes of the same protein to confirm results.

  • Orthogonal methods: Validate findings using non-antibody-based methods (e.g., mass spectrometry).

  • Genetic models: Verify specificity using genetic knockout or knockdown models where the target protein is absent or significantly reduced.

  • Species-specific validation: Thoroughly validate antibodies when transitioning between species, as cross-reactivity patterns can differ significantly.

This multi-faceted approach helps distinguish specific signal from non-specific interactions and increases confidence in experimental results .

How should researchers standardize SPNS2 antibody data for comparative analyses?

Standardization of SPNS2 antibody data requires:

  • Reference standards: Include standard positive and negative controls in each experiment.

  • Normalization protocols: Normalize signals to appropriate housekeeping proteins or total protein staining.

  • Quantification methods: Use consistent quantification methodologies across experiments (e.g., integrated density measurements for Western blots).

  • Metadata documentation: Record detailed metadata including antibody lot numbers, dilutions, and incubation conditions.

  • Statistical analysis: Apply appropriate statistical tests based on data distribution and experimental design.

\text{Normalized SPNS2 Signal} = \frac{\text{SPNS2 Signal Intensity}}{\text{Reference Protein Signal Intensity}}

This standardization enables meaningful comparisons between experiments and laboratories while minimizing technical variability .

What immunogenicity considerations are important when using SPNS2 antibodies in translational research?

In translational research contexts:

  • Anti-drug antibody (ADA) monitoring: Implement multi-tiered testing schemes including screening, confirmation, and neutralization assays.

  • Classification of antibody responses: Distinguish between non-neutralizing antibodies (non-NAbs) and neutralizing antibodies (NAbs).

  • Pharmacokinetic/pharmacodynamic (PK/PD) impact: Assess how antibody responses affect therapeutic pharmacokinetics and pharmacodynamics.

  • Safety implications: Monitor for adverse events associated with immunogenicity.

  • Data mapping: Structure immunogenicity data according to CDISC standards (e.g., Immunogenicity Specimen Assessments domain).

These considerations are critical for translational studies involving therapeutic antibodies, as immune responses can significantly affect safety, efficacy, and durability of treatment effects .

How can researchers integrate SPNS2 antibody data with other -omics approaches?

Integration of antibody-based data with -omics approaches:

  • Correlation analysis: Correlate protein expression data from antibody-based methods with transcriptomic data.

  • Network analysis: Place SPNS2 in biological networks using protein-protein interaction data combined with antibody-based co-immunoprecipitation data.

  • Functional validation: Use antibodies to validate findings from genomic or proteomic screens through targeted interventions.

  • Multi-omics platforms: Implement platforms that allow simultaneous analysis of proteins, metabolites, and transcripts.

  • Data visualization: Develop visualization tools that integrate multiple data types to identify patterns and relationships.

This integrated approach provides a more comprehensive understanding of SPNS2 function and places antibody-derived data in broader biological context.

What are the most common causes of false positives/negatives with SPNS2 antibodies and how can they be addressed?

Common causes of false results include:

IssuePotential CausesSolutions
False positivesCross-reactivity with similar proteinsUse highly specific antibodies validated against knockout controls
Non-specific binding to other cellular componentsOptimize blocking conditions and washing steps
Secondary antibody cross-reactivityUse species-appropriate secondary antibodies
False negativesEpitope masking by protein-protein interactionsTry multiple antibodies targeting different epitopes
Low expression levelsIncrease protein loading or use more sensitive detection methods
Protein degradationInclude protease inhibitors and maintain appropriate sample conditions
Ineffective antibody concentrationTitrate antibody to determine optimal concentration

Implementing appropriate controls and validating with multiple methods helps identify and address these issues .

How can researchers optimize SPNS2 detection in challenging tissue types or subcellular compartments?

For challenging detection scenarios:

  • Antigen retrieval optimization: Test multiple antigen retrieval methods (heat-induced, enzymatic, pH variations) to maximize epitope accessibility.

  • Signal amplification: Employ tyramide signal amplification or other amplification methods for low-abundance targets.

  • Subcellular fractionation: Enrich for specific compartments before analysis to increase signal-to-noise ratio.

  • Fixation optimization: Test multiple fixation protocols to preserve both structure and antigenicity.

  • Confocal microscopy: Use high-resolution imaging to precisely localize subcellular signals.

  • Super-resolution techniques: Implement STORM, PALM, or other super-resolution approaches for detailed localization studies.

  • Multi-label approaches: Combine SPNS2 antibodies with markers for specific organelles or structures to improve interpretation.

These approaches help overcome limitations in detecting SPNS2 in challenging contexts where standard protocols may be insufficient.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.