SRCIN1 Antibody

Shipped with Ice Packs
In Stock

Description

Introduction to SRCIN1 and SRCIN1 Antibodies

SRCIN1 (SRC Kinase Signaling Inhibitor 1) is a novel regulatory protein that modulates Src activation through C-terminal Src kinase (Csk) . Also known as p140Cap, SNIP (SNAP-25-interacting protein), and p130Cas-associated protein, SRCIN1 plays crucial roles in regulating cell migration, cellular spreading, and calcium-dependent exocytosis . The protein has a calculated molecular weight of approximately 140 kDa and is primarily localized in the cytoplasm and plasma membrane .

SRCIN1 antibodies are immunoglobulins specifically designed to recognize and bind to the SRCIN1 protein. These antibodies have become essential tools in molecular biology and cancer research, enabling scientists to study SRCIN1 expression patterns, protein interactions, and functional roles in various physiological and pathological processes.

The development of high-quality SRCIN1 antibodies has facilitated significant advances in understanding this protein's complex roles in different cellular contexts, particularly in cancer development and progression. These antibodies vary in their characteristics, including host species, clonality, applications, and epitope specificity, providing researchers with multiple options for their experimental needs.

Types and Characteristics of SRCIN1 Antibodies

SRCIN1 antibodies are available in various forms, each with specific characteristics suitable for different research applications. These antibodies are primarily categorized based on their source, clonality, and conjugation status.

Formulations and Conjugates

SRCIN1 antibodies are available in various formulations to suit different experimental requirements:

  1. Unconjugated antibodies: The most common form, suitable for a wide range of applications

  2. Biotin-conjugated antibodies: Useful for detection systems utilizing avidin-biotin complexes

  3. Fluorescent dye-conjugated antibodies (e.g., Cy3, DyLight488): Valuable for direct detection in immunofluorescence applications

Many SRCIN1 antibodies are supplied as lyophilized preparations that require reconstitution before use, typically in buffered solutions containing stabilizers like trehalose . Others are provided as ready-to-use solutions in buffered aqueous glycerol .

Applications and Reactivity

SRCIN1 antibodies are validated for multiple applications, as summarized in Table 1:

ApplicationTypical Dilution/ConcentrationSuppliers Offering Validated Antibodies
Western Blot (WB)0.5-1 μg/mlSigma-Aldrich, NSJ Bioreagents, BosterBio, Proteintech Group
Immunohistochemistry (IHC)1-50 μg/ml (varies by product)Sigma-Aldrich, BosterBio, NSJ Bioreagents
Flow Cytometry (FC)1-3 μg/10^6 cellsNSJ Bioreagents, BosterBio
ELISA0.1-0.5 μg/mlNSJ Bioreagents, BosterBio, antibodies-online
Immunocytochemistry (ICC)Varies by productBosterBio, Novus Biologicals
Immunoprecipitation (IP)Varies by productProteintech Group, Invitrogen Antibodies

Expression Patterns of SRCIN1 in Normal and Cancerous Tissues

Understanding the expression patterns of SRCIN1 in various tissues is crucial for interpreting antibody-based detection results and for elucidating the protein's physiological and pathological roles.

SRCIN1 Expression in Normal Human Tissues

Tissue microarray analyses using SRCIN1 antibodies have revealed differential expression of SRCIN1 across various normal human tissues . The expression profile is summarized in Table 2:

Tissue TypeSRCIN1 Expression LevelPercentage of Positive Samples
BreastStrong cytoplasmic100% (5/5)
CerebrumStrong cytoplasmic100% (5/5)
LiverStrong cytoplasmic100% (5/5)
SkinStrong cytoplasmic100% (5/5)
KidneyStrong cytoplasmic80% (4/5)
TestisStrong cytoplasmic80% (4/5)
StomachStrong cytoplasmic80% (4/5)
LungModerate cytoplasmic60% (3/5)
PancreasWeak cytoplasmic20% (1/5)
Colon/RectumNegative or weak20% (1/5)
EsophagusNegative0% (0/5)
OvaryNegative0% (0/5)
ProstateNegative0% (0/5)
UterusNegative0% (0/5)

This expression pattern highlights the tissue-specific nature of SRCIN1 expression, with particularly strong expression in breast, cerebrum, liver, and skin tissues .

SRCIN1 Expression in Cancer Tissues

Immunohistochemical analyses using SRCIN1 antibodies have revealed altered expression patterns in cancer tissues compared to their normal counterparts. In colorectal cancer (CRC), SRCIN1 expression is significantly upregulated compared to normal colorectal mucosa . Specifically:

  1. Predominantly cytoplasmic SRCIN1 staining was observed in 84% (21/25) of CRC cases

  2. All CRC metastatic lymph nodes (100%, 8/8) showed positive SRCIN1 staining

  3. Western blotting analyses showed higher SRCIN1 expression in 70% (7/10) of cancerous colon tissues compared to matched normal tissues

SRCIN1 is also expressed across various colorectal cancer cell lines, including LS174T, SW1116, SW620, LoVo, SW480, CaCo, DLD1, and HT29 . This upregulation suggests a potential oncogenic role of SRCIN1 in CRC development and progression.

Functional Roles of SRCIN1 in Cancer Progression

Research utilizing SRCIN1 antibodies has revealed complex and sometimes contradictory roles of SRCIN1 in different cancer types. These findings highlight the context-dependent nature of SRCIN1 function and underscore the importance of reliable antibody-based detection methods for accurate characterization.

SRCIN1 in Colorectal Cancer

In colorectal cancer, SRCIN1 appears to function as an oncogene, promoting tumor growth and metastasis . Studies using SRCIN1 antibodies for protein detection have revealed several key findings:

  1. SRCIN1 knockdown by siRNA induces cell differentiation in CRC cells, as evidenced by:

    • Altered F-actin distribution

    • Increased expression of the differentiation marker E-cadherin

  2. SRCIN1 affects cell cycle progression in CRC cells:

    • SRCIN1 knockdown results in G0/G1 cell cycle arrest

    • SRCIN1 knockdown decreases expression of cyclin D1 and CDK6

    • SRCIN1 overexpression promotes cell proliferation

  3. SRCIN1 influences CRC cell growth:

    • Growth rates of vector-transfected cells: 100%, 260.80±9.33%, and 477.84±35.09% at 12, 24, and 48 hours

    • Growth rates of SRCIN1-expressing cells: 100%, 371.48±13.87%, and 1168.31±176.82% at the same time points

    • Growth rates of SRCIN1-siRNA-transfected cells were significantly lower than control cells

  4. SRCIN1 promotes migration and invasion in CRC cells:

    • SRCIN1 upregulation increased migration index by 12% and 24% at 12 and 36 hours

    • SRCIN1 knockdown decreased migration index by 30% and 28% at 24 and 48 hours

    • Invasiveness of LoVo cells transfected with SRCIN1 increased by 110.6% compared to control cells

    • After SRCIN1 knockdown, invasiveness decreased by 269.5% compared to control cells

  5. SRCIN1 activates the Wnt/β-catenin signaling pathway in CRC cells

  6. SRCIN1 suppression sensitizes CRC cells to 5-fluorouracil (5-FU)-induced apoptosis

These findings suggest that SRCIN1 contributes to colorectal cancer carcinogenesis, invasion, and metastasis, potentially serving as a therapeutic target .

SRCIN1 in Non-Small Cell Lung Cancer (NSCLC)

In contrast to its role in colorectal cancer, SRCIN1 appears to function as a tumor suppressor in non-small cell lung cancer (NSCLC) . Research utilizing SRCIN1 antibodies has shown that:

  1. SRCIN1 overexpression suppresses NSCLC cell proliferation:

    • Reduced proliferation observed in A549 and NCI-H1650 cells

    • Decreased EdU uptake in HCC827 and H1299 cells

  2. SRCIN1 inhibits NSCLC cell invasion:

    • Reduced invasive capacity in both A549 and NCI-H1650 cells

  3. SRCIN1 regulates epithelial-mesenchymal transition (EMT) in NSCLC cells:

    • SRCIN1 overexpression increases E-cadherin expression

    • SRCIN1 overexpression decreases Slug, Vimentin, and N-cadherin expression

    • SRCIN1 knockdown produces opposite effects

  4. SRCIN1 is targeted by miR-657 in NSCLC:

    • miR-657 is upregulated in NSCLC tissues and cell lines

    • miR-657 targets SRCIN1 via the Slug pathway to promote NSCLC development

These findings indicate that SRCIN1 functions as an inhibitor of NSCLC cell invasion, proliferation, and EMT induction, highlighting its tumor-suppressive role in this cancer type .

SRCIN1 in Other Cancer Types

SRCIN1 has also been investigated in other cancer types, with varying roles observed:

  1. Breast cancer: SRCIN1 functions as a tumor suppressor, strongly impairing breast cancer cell growth

  2. Osteosarcoma: SRCIN1 enhances E-cadherin expression and suppresses osteosarcoma cell growth

These diverse roles across different cancer types underscore the context-dependent nature of SRCIN1 function and highlight the need for comprehensive studies using reliable SRCIN1 antibodies for accurate characterization.

Immunogens and Epitopes

Commercial SRCIN1 antibodies are generated against various regions of the SRCIN1 protein. For example:

  1. Sigma-Aldrich HPA009701: Immunogen sequence NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRR

  2. NSJ Bioreagents RQ4950: Amino acids E189-E287 from the human protein

Knowledge of the specific epitope recognized by an antibody is important for experimental design, particularly when studying protein domains, post-translational modifications, or protein-protein interactions involving SRCIN1.

Research Applications of SRCIN1 Antibodies

SRCIN1 antibodies have been utilized in various research applications to elucidate the protein's expression patterns, functional roles, and potential as a therapeutic target.

Immunohistochemical Analysis

Immunohistochemistry using SRCIN1 antibodies has been instrumental in characterizing the expression patterns of SRCIN1 in normal and cancerous tissues. These analyses have revealed:

  1. Differential expression across normal human tissues

  2. Upregulation in colorectal cancer tissues and metastatic lymph nodes

  3. Correlation between SRCIN1 expression and tumor progression

For example, in colorectal cancer studies, paraffin-embedded tissue sections were stained with SRCIN1 antibodies to assess protein expression. The results showed predominantly cytoplasmic staining in CRC cells, with stronger intensity compared to normal colorectal mucosa .

Western Blot Analysis

Western blotting with SRCIN1 antibodies has been used to quantify SRCIN1 protein levels in tissue samples and cell lines. This technique has enabled researchers to:

  1. Compare SRCIN1 expression between normal and cancerous tissues

  2. Assess SRCIN1 expression across different cancer cell lines

  3. Confirm successful overexpression or knockdown of SRCIN1 in experimental studies

For instance, western blot analysis of matched normal colon and cancerous colon tissues revealed higher SRCIN1 expression in 70% of the cancerous specimens . Similarly, western blotting confirmed the expression of SRCIN1 in various colorectal cancer cell lines, including LS174T, SW1116, SW620, LoVo, SW480, CaCo, DLD1, and HT29 .

Functional Studies

SRCIN1 antibodies have been essential tools in functional studies investigating the protein's role in cancer cell behavior. These studies typically involve:

  1. Manipulating SRCIN1 expression (overexpression or knockdown)

  2. Assessing the effects on cell proliferation, migration, invasion, and other phenotypes

  3. Using SRCIN1 antibodies to confirm the success of expression manipulation

For example, in studies of NSCLC, SRCIN1 overexpression and knockdown were confirmed by western blotting with SRCIN1 antibodies before assessing the effects on cell proliferation and invasion . Similarly, in colorectal cancer studies, SRCIN1 antibodies were used to verify successful transfection with SRCIN1-siRNA before functional assays .

Product Specs

Buffer
Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
Form
Liquid
Lead Time
Typically, we can ship the products within 1-3 business days after receiving your order. Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Synonyms
p130Cas associated protein antibody; p130Cas-associated protein antibody; P140 antibody; p140Cap antibody; SNAP-25-interacting protein antibody; SNIP antibody; SRC kinase signaling inhibitor 1 antibody; SRCIN1 antibody; SRCN1_HUMAN antibody
Target Names
SRCIN1
Uniprot No.

Target Background

Function
SRCIN1 acts as a negative regulator of SRC by activating CSK, which inhibits SRC activity and downstream signaling. This inhibition leads to impaired cell spreading and migration. SRCIN1 also regulates dendritic spine morphology and is involved in calcium-dependent exocytosis. It may play a role in neurotransmitter release or synapse maintenance.
Gene References Into Functions

Gene References into Functions:

  1. SRCIN1 inhibits the proliferation and epithelial-mesenchymal transition (EMT) of human liver cancer HepG2 cells. PMID: 28550679
  2. Data indicates that p140Cap interferes with ERBB2-dependent activation of Rac GTPase-controlled circuitries. PMID: 28300085
  3. A study demonstrates a critical role of presynaptic cadherin/catenin/p140Cap cell adhesion complexes in stabilizing functional synapses and spines in the developing neocortex. PMID: 28641114
  4. SRCIN1 underexpression is associated with Osteosarcoma. PMID: 27513473
  5. SRCIN1 contributes to colorectal cancer (CRC) carcinogenesis, invasion, and metastasis. These findings suggest the potential for SRCIN1-targeted therapies in CRC treatment. PMID: 28393242
  6. miR-211 may function as an oncogenic miRNA in non-small cell lung cancer, partly by regulating SRCIN1. PMID: 26277787
  7. miR-346 may function as an oncogenic miRNA and mediate chemosensitivity to docetaxel through targeting SRCIN1 in breast cancer. PMID: 27913185
  8. Postsynaptic endophilin A1 plays a novel role in spine morphogenesis, stabilization, and synaptic function through the regulation of p140Cap. PMID: 25771685
  9. miR-374a functions as a candidate oncogene in gastric cancer by directly targeting SRCIN1. PMID: 25554419
  10. miR-150 acts as an oncogene in lung cancer through the inhibition of SRCIN1 translation. PMID: 24456795
  11. p140Cap phosphorylation sites and binding to Csk and Abl kinase. PMID: 23383002
  12. p140Cap immobilizes E-cadherin at the cell membrane and inhibits EGFR and Erk1/2 signaling, blocking scatter and proliferation of cancer cells. PMID: 20453886
  13. p140Cap is a novel negative regulator of tumor growth. PMID: 17525734
  14. Expression of SNIP/p140Cap significantly correlates with unfavorable overall survival, suggesting its potential as a diagnostic and prognostic marker, as well as a therapeutic target, in breast cancer. PMID: 18475297

Show More

Hide All

Database Links

HGNC: 29506

OMIM: 610786

KEGG: hsa:80725

STRING: 9606.ENSP00000264659

UniGene: Hs.448872

Protein Families
SRCIN1 family
Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse, presynapse. Cell junction, synapse, postsynapse. Cell junction, synapse, postsynaptic density.
Tissue Specificity
Expressed in some primary breast carcinomas where its presence is significantly associated with increased tumor size. Not detected in normal breast tissue.

Q&A

What is the expression pattern of SRCIN1 across normal tissues and cancer?

SRCIN1 shows variable expression across human tissues. Immunohistochemistry studies using tissue microarrays have revealed:

  • Strong cytoplasmic immunoreactivity (100%) in breast, cerebrum, liver, and skin tissues

  • Moderate to strong cytoplasmic expression (80%) in kidney, testis, and stomach

  • Lower expression (60%) in lung and minimal expression (20%) in pancreas

  • Negative expression in esophagus, ovary, prostate, and uterus

Notably, 80% of normal colorectal tissues show negative SRCIN1 expression, while 84% of colorectal cancer tissues and 100% of CRC metastatic lymph nodes exhibit positive SRCIN1 expression . In contrast, SRCIN1 is downregulated in non-small cell lung cancer (NSCLC) compared to adjacent normal tissues . This differential expression pattern underscores the context-dependent role of SRCIN1 in different cancer types.

What validated applications are available for SRCIN1 antibodies?

SRCIN1 antibodies have been validated for multiple research applications:

  • Western blotting (WB): Effective for detecting SRCIN1 protein (approximately 140 kDa) in human cancer cell lines (T-47D, MDA-MB-453), rat and mouse brain tissue lysates

  • Immunohistochemistry (IHC-P): Successfully used on paraffin-embedded sections of human tissues (appendicitis, ovarian cancer, placenta, esophagus squamous cancer)

  • Immunocytochemistry (ICC): Applied to cultured cells to visualize cellular localization

  • Immunofluorescence (IF): Used to examine subcellular distribution

  • Flow Cytometry: Validated for cell surface expression analysis

  • ELISA: Confirmed for quantitative protein detection

Optimal antibody concentration varies by application, with typical working dilutions ranging from 0.5 μg/mL for Western blot to 1 μg/mL for immunohistochemistry .

How should experiments be designed to investigate SRCIN1's contradictory roles in different cancer types?

When investigating SRCIN1's apparently contradictory functions across cancer types, consider these methodological approaches:

  • Comparative expression analysis: Perform systematic comparison of SRCIN1 expression across multiple cancer types using matched tumor and adjacent normal tissues. Western blotting analysis of 10 pairs of matched normal and cancerous colon tissue revealed higher SRCIN1 expression in 70% of tumor samples .

  • Context-specific signaling pathway analysis: Examine SRCIN1 interactions with different downstream effectors:

    • In colorectal cancer: Assess interactions with Wnt/β-catenin pathway components

    • In breast cancer: Focus on Src and STAT3 pathway inhibition

    • In non-small cell lung cancer: Examine interactions with miR-657 and the Slug pathway

  • Functional validation through gene modulation: Use siRNA knockdown and overexpression experiments across different cell lines representing various cancer types. For example:

    • In CRC cells (LoVo, SW1116): SRCIN1 knockdown induced cell differentiation, increased E-cadherin expression, and caused G0/G1 cell cycle arrest

    • In NSCLC cells (A549, NCI-H1650): SRCIN1 overexpression suppressed proliferation, invasion, and EMT by regulating Slug, E-cadherin, Vimentin, and N-cadherin expression

  • Tissue microenvironment considerations: Examine SRCIN1 function in 3D culture systems that better recapitulate in vivo conditions, such as MDCK cysts as a structural model of renal tubules .

What methodological considerations are important when using SRCIN1 antibodies for investigating its role in lipid rafts?

SRCIN1 localization to lipid rafts is critical for its signaling functions. When investigating this aspect:

  • Lipid raft isolation protocol optimization:

    • Use appropriate detergent-resistant membrane fractionation techniques

    • Verify fractionation quality with known lipid raft markers

    • The search results indicate CDCP1 (a related protein) controls lipid raft localization of SFKs including Src

  • Antibody selection for lipid raft studies:

    • Use antibodies validated for detecting SRCIN1 in its native conformational state

    • Consider using non-denaturing conditions for some applications

    • Verify antibody specificity in fractionated samples

  • Mutant constructs as controls:

    • Include SRCIN1 mutants lacking lipid raft localization signals (similar to the CDCP1-CG mutant mentioned in the research)

    • Compare wild-type vs. mutant SRCIN1 localization patterns and functional effects

  • Co-localization studies:

    • Perform double immunofluorescence staining of SRCIN1 with established lipid raft markers

    • Use confocal microscopy with appropriate resolution for membrane microdomain visualization

  • Functional readouts:

    • Assess how lipid raft disruption (via cholesterol depletion) affects SRCIN1-dependent signaling

    • Compare Src activation in lipid raft vs. non-lipid raft fractions, as shown in the research on related SFK pathways

How can SRCIN1 antibodies be effectively used to study its role in therapeutic resistance?

SRCIN1 has been implicated in therapeutic sensitivity and resistance mechanisms:

  • Combination therapy experimental design:

    • In colorectal cancer models, SRCIN1 suppression enhanced sensitivity to 5-fluorouracil (5-FU) both in vitro and in vivo

    • For KRAS-G12C mutant cancers, Src inhibition overcame resistance to KRAS-targeted therapy

    • Design experiments combining SRCIN1 modulation with standard chemotherapeutics or targeted therapies

  • Resistance model development:

    • Establish therapy-resistant cell lines through stepwise drug exposure

    • Compare SRCIN1 expression and localization between parental and resistant cells

    • In neuroblastoma, p140Cap/SRCIN1 increased sensitivity to doxorubicin and etoposide treatment

  • Mechanistic pathway analysis:

    • Use phospho-specific antibodies to detect activation status of SRCIN1-regulated pathways

    • Examine changes in EMT markers (E-cadherin, N-cadherin, Vimentin) in response to therapy with and without SRCIN1 modulation

    • Assess Wnt/β-catenin pathway activation, as SRCIN1 was shown to induce this pathway in colorectal cancer

  • In vivo validation protocols:

    • Utilize xenograft models to assess how SRCIN1 modulation affects therapeutic response

    • Consider patient-derived xenografts to better recapitulate clinical scenarios

    • SRCIN1 knockdown inhibited xenograft tumorigenesis and enhanced effectiveness of 5-FU chemotherapy in established CRC xenografts

What approaches should be used to validate SRCIN1 antibody specificity for specific applications?

Ensuring antibody specificity is critical for reliable research outcomes:

  • Multi-method validation approach:

    • Cross-validate results using at least two different antibodies targeting distinct epitopes

    • Compare commercial antibodies with in-house validated reagents when possible

    • Verify antibody specificity across multiple cell lines and tissue types

  • Knockdown/knockout controls:

    • Include SRCIN1 knockdown (siRNA/shRNA) or knockout (CRISPR-Cas9) samples

    • The search results show successful validation using SRCIN1 siRNA in LoVo and SW1116 cell lines

    • Western blotting confirmed effective knockdown and overexpression with 70-80% efficiency

  • Recombinant protein controls:

    • Use purified recombinant SRCIN1 protein as a positive control

    • Perform peptide competition assays to confirm epitope specificity

    • Consider using tagged recombinant SRCIN1 for dual detection strategies

  • Application-specific validation:

    • For IHC: Include multiple tissue types known to express or lack SRCIN1

    • For WB: Confirm appropriate molecular weight (approximately 140 kDa)

    • For IP: Verify pull-down of known SRCIN1 interaction partners

  • Cross-species reactivity assessment:

    • Test antibody performance across human, mouse, and rat samples if cross-reactivity is claimed

    • The examined antibodies showed reactivity with human, mouse and rat SRCIN1

What are the best methodological approaches for studying SRCIN1's interaction with microRNAs?

Several microRNAs have been shown to regulate SRCIN1 expression in cancer:

  • miRNA target validation techniques:

    • Luciferase reporter assays: Confirm direct targeting of SRCIN1 3'UTR

      • In NSCLC, miR-657 was shown to directly target SRCIN1 using wild-type and mutant 3'UTR luciferase constructs

      • Similarly, miR-665 was demonstrated to target SRCIN1 in ovarian cancer

    • RNA immunoprecipitation (RIP) assays: Verify physical interaction between miRNAs and SRCIN1 mRNA

    • RNA pull-down assays: Confirm binding of specific miRNAs to SRCIN1

  • Expression correlation analysis:

    • Perform qPCR to analyze inverse correlation between miRNA and SRCIN1 levels

    • In NSCLC tissues, miR-657 and SRCIN1 showed significant negative correlation (Pearson correlation analysis)

  • Functional rescue experiments:

    • Conduct miRNA overexpression with concurrent SRCIN1 rescue experiments

    • Design experiments testing whether SRCIN1 overexpression can reverse miRNA-induced phenotypes

    • In NSCLC, SRCIN1 overexpression partially reversed miR-657's effects on cell proliferation and invasion

  • Pathway analysis downstream of miRNA-SRCIN1 interaction:

    • Examine effects on known SRCIN1 pathways (Src, STAT3, Wnt/β-catenin)

    • Assess changes in EMT markers, which are commonly regulated by SRCIN1

    • In NSCLC, the miR-657-SRCIN1 axis was shown to regulate the Slug pathway

What sample preparation protocols optimize SRCIN1 detection in different applications?

For optimal SRCIN1 detection, consider these application-specific protocols:

  • Western Blotting:

    • Use 5-20% SDS-PAGE gels for optimal separation of the 140 kDa SRCIN1 protein

    • Apply 50 μg of protein sample under reducing conditions

    • Run electrophoresis at 70V (stacking gel)/90V (resolving gel) for 2-3 hours

    • Transfer to nitrocellulose membrane at 150 mA for 50-90 minutes

    • Block with 5% non-fat milk in TBS for 1.5 hours at room temperature

    • Incubate with primary antibody at 0.5 μg/mL overnight at 4°C

    • Wash with TBS-0.1% Tween (3 times, 5 minutes each)

    • Incubate with HRP-conjugated secondary antibody (1:10000 dilution) for 1.5 hours at room temperature

    • Develop using enhanced chemiluminescence detection

  • Immunohistochemistry:

    • Perform heat-mediated antigen retrieval in citrate buffer (pH 6.0) for 20 minutes

    • Block tissue sections with 10% goat serum

    • Incubate with primary antibody at 1 μg/ml overnight at 4°C

    • Use biotinylated secondary antibody (30 minutes at 37°C)

    • Develop using Streptavidin-Biotin-Complex with DAB as chromogen

  • Cell Fractionation for Lipid Raft Analysis:

    • Use appropriate detergent-resistant membrane isolation protocols

    • Verify fractionation quality with established lipid raft markers

    • Compare protein distribution across fractions

    • Include controls for non-lipid raft membrane fractions

How should researchers address potential discrepancies in SRCIN1 detection across different experimental systems?

When encountering discrepancies in SRCIN1 detection:

  • Antibody validation across systems:

    • Verify antibody performance in your specific experimental system

    • Consider testing multiple antibodies targeting different epitopes

    • Assess potential cross-reactivity with related proteins

  • Technical optimization for specific tissues/cells:

    • Adjust lysis buffers for different tissue types (brain tissue may require different processing than epithelial tissues)

    • Optimize antigen retrieval methods for different fixation protocols

    • Consider native vs. denatured protein detection methods

  • Analysis of SRCIN1 isoforms and post-translational modifications:

    • Investigate potential tissue-specific isoforms or modifications

    • Use phospho-specific antibodies when investigating signaling activity

    • Consider proteolytic processing, as SRCIN1 may undergo cleavage similar to related proteins

  • Control for contextual protein expression:

    • Include positive and negative control samples in each experiment

    • Use recombinant SRCIN1 as a standard for quantitative comparisons

    • Document experimental conditions thoroughly to enable troubleshooting

The research demonstrates significant variation in SRCIN1 expression and function across tissue types and cancer contexts, so methodological consistency is crucial for reliable results .

How can SRCIN1 antibodies be used to investigate its role in cancer progression and metastasis?

SRCIN1 plays complex roles in cancer progression that can be investigated using the following approaches:

  • Multi-step cancer progression analysis:

    • Compare SRCIN1 expression across normal tissue, primary tumors, and metastatic lesions

    • In colorectal cancer, SRCIN1 was negative in 80% of normal tissues but positive in 84% of primary tumors and 100% of metastatic lymph nodes

    • Use tissue microarrays to assess SRCIN1 expression across large sample sets

  • Invasion and migration functional assays:

    • Perform Transwell invasion assays with SRCIN1 knockdown or overexpression

    • Conduct wound healing assays to assess migration capacity

    • SRCIN1 overexpression suppressed the invasiveness of A549 and NCI-H1650 NSCLC cells in vitro

  • EMT marker analysis:

    • Examine E-cadherin, N-cadherin, Vimentin, and Slug expression following SRCIN1 modulation

    • SRCIN1 knockdown in CRC cells increased E-cadherin expression, suggesting induction of differentiation

    • In NSCLC, SRCIN1 overexpression increased E-cadherin while reducing Slug, Vimentin, and N-cadherin

  • Signaling pathway activation markers:

    • Assess Src activity (phospho-Src) and downstream effectors

    • Examine STAT3 phosphorylation status

    • Evaluate β-catenin nuclear localization to assess Wnt pathway activation

    • SRCIN1 was shown to induce Wnt/β-catenin signaling in CRC cells

  • In vivo metastasis models:

    • Utilize tail vein injection or orthotopic implantation models

    • Analyze spontaneous metastasis in xenograft models

    • SRCIN1 knockdown in neuroblastoma reduced spontaneous lung metastasis formation

What experimental designs best demonstrate SRCIN1's role in therapeutic sensitivity?

To investigate SRCIN1's impact on therapeutic responses:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.