SRCIN1 (SRC Kinase Signaling Inhibitor 1) is a novel regulatory protein that modulates Src activation through C-terminal Src kinase (Csk) . Also known as p140Cap, SNIP (SNAP-25-interacting protein), and p130Cas-associated protein, SRCIN1 plays crucial roles in regulating cell migration, cellular spreading, and calcium-dependent exocytosis . The protein has a calculated molecular weight of approximately 140 kDa and is primarily localized in the cytoplasm and plasma membrane .
SRCIN1 antibodies are immunoglobulins specifically designed to recognize and bind to the SRCIN1 protein. These antibodies have become essential tools in molecular biology and cancer research, enabling scientists to study SRCIN1 expression patterns, protein interactions, and functional roles in various physiological and pathological processes.
The development of high-quality SRCIN1 antibodies has facilitated significant advances in understanding this protein's complex roles in different cellular contexts, particularly in cancer development and progression. These antibodies vary in their characteristics, including host species, clonality, applications, and epitope specificity, providing researchers with multiple options for their experimental needs.
SRCIN1 antibodies are available in various forms, each with specific characteristics suitable for different research applications. These antibodies are primarily categorized based on their source, clonality, and conjugation status.
SRCIN1 antibodies are available in various formulations to suit different experimental requirements:
Unconjugated antibodies: The most common form, suitable for a wide range of applications
Biotin-conjugated antibodies: Useful for detection systems utilizing avidin-biotin complexes
Fluorescent dye-conjugated antibodies (e.g., Cy3, DyLight488): Valuable for direct detection in immunofluorescence applications
Many SRCIN1 antibodies are supplied as lyophilized preparations that require reconstitution before use, typically in buffered solutions containing stabilizers like trehalose . Others are provided as ready-to-use solutions in buffered aqueous glycerol .
SRCIN1 antibodies are validated for multiple applications, as summarized in Table 1:
Understanding the expression patterns of SRCIN1 in various tissues is crucial for interpreting antibody-based detection results and for elucidating the protein's physiological and pathological roles.
Tissue microarray analyses using SRCIN1 antibodies have revealed differential expression of SRCIN1 across various normal human tissues . The expression profile is summarized in Table 2:
| Tissue Type | SRCIN1 Expression Level | Percentage of Positive Samples |
|---|---|---|
| Breast | Strong cytoplasmic | 100% (5/5) |
| Cerebrum | Strong cytoplasmic | 100% (5/5) |
| Liver | Strong cytoplasmic | 100% (5/5) |
| Skin | Strong cytoplasmic | 100% (5/5) |
| Kidney | Strong cytoplasmic | 80% (4/5) |
| Testis | Strong cytoplasmic | 80% (4/5) |
| Stomach | Strong cytoplasmic | 80% (4/5) |
| Lung | Moderate cytoplasmic | 60% (3/5) |
| Pancreas | Weak cytoplasmic | 20% (1/5) |
| Colon/Rectum | Negative or weak | 20% (1/5) |
| Esophagus | Negative | 0% (0/5) |
| Ovary | Negative | 0% (0/5) |
| Prostate | Negative | 0% (0/5) |
| Uterus | Negative | 0% (0/5) |
This expression pattern highlights the tissue-specific nature of SRCIN1 expression, with particularly strong expression in breast, cerebrum, liver, and skin tissues .
Immunohistochemical analyses using SRCIN1 antibodies have revealed altered expression patterns in cancer tissues compared to their normal counterparts. In colorectal cancer (CRC), SRCIN1 expression is significantly upregulated compared to normal colorectal mucosa . Specifically:
Predominantly cytoplasmic SRCIN1 staining was observed in 84% (21/25) of CRC cases
All CRC metastatic lymph nodes (100%, 8/8) showed positive SRCIN1 staining
Western blotting analyses showed higher SRCIN1 expression in 70% (7/10) of cancerous colon tissues compared to matched normal tissues
SRCIN1 is also expressed across various colorectal cancer cell lines, including LS174T, SW1116, SW620, LoVo, SW480, CaCo, DLD1, and HT29 . This upregulation suggests a potential oncogenic role of SRCIN1 in CRC development and progression.
Research utilizing SRCIN1 antibodies has revealed complex and sometimes contradictory roles of SRCIN1 in different cancer types. These findings highlight the context-dependent nature of SRCIN1 function and underscore the importance of reliable antibody-based detection methods for accurate characterization.
In colorectal cancer, SRCIN1 appears to function as an oncogene, promoting tumor growth and metastasis . Studies using SRCIN1 antibodies for protein detection have revealed several key findings:
SRCIN1 knockdown by siRNA induces cell differentiation in CRC cells, as evidenced by:
Altered F-actin distribution
Increased expression of the differentiation marker E-cadherin
SRCIN1 affects cell cycle progression in CRC cells:
SRCIN1 knockdown results in G0/G1 cell cycle arrest
SRCIN1 knockdown decreases expression of cyclin D1 and CDK6
SRCIN1 overexpression promotes cell proliferation
SRCIN1 influences CRC cell growth:
Growth rates of vector-transfected cells: 100%, 260.80±9.33%, and 477.84±35.09% at 12, 24, and 48 hours
Growth rates of SRCIN1-expressing cells: 100%, 371.48±13.87%, and 1168.31±176.82% at the same time points
Growth rates of SRCIN1-siRNA-transfected cells were significantly lower than control cells
SRCIN1 promotes migration and invasion in CRC cells:
SRCIN1 upregulation increased migration index by 12% and 24% at 12 and 36 hours
SRCIN1 knockdown decreased migration index by 30% and 28% at 24 and 48 hours
Invasiveness of LoVo cells transfected with SRCIN1 increased by 110.6% compared to control cells
After SRCIN1 knockdown, invasiveness decreased by 269.5% compared to control cells
SRCIN1 activates the Wnt/β-catenin signaling pathway in CRC cells
SRCIN1 suppression sensitizes CRC cells to 5-fluorouracil (5-FU)-induced apoptosis
These findings suggest that SRCIN1 contributes to colorectal cancer carcinogenesis, invasion, and metastasis, potentially serving as a therapeutic target .
In contrast to its role in colorectal cancer, SRCIN1 appears to function as a tumor suppressor in non-small cell lung cancer (NSCLC) . Research utilizing SRCIN1 antibodies has shown that:
SRCIN1 overexpression suppresses NSCLC cell proliferation:
Reduced proliferation observed in A549 and NCI-H1650 cells
Decreased EdU uptake in HCC827 and H1299 cells
SRCIN1 inhibits NSCLC cell invasion:
Reduced invasive capacity in both A549 and NCI-H1650 cells
SRCIN1 regulates epithelial-mesenchymal transition (EMT) in NSCLC cells:
SRCIN1 overexpression increases E-cadherin expression
SRCIN1 overexpression decreases Slug, Vimentin, and N-cadherin expression
SRCIN1 knockdown produces opposite effects
SRCIN1 is targeted by miR-657 in NSCLC:
miR-657 is upregulated in NSCLC tissues and cell lines
miR-657 targets SRCIN1 via the Slug pathway to promote NSCLC development
These findings indicate that SRCIN1 functions as an inhibitor of NSCLC cell invasion, proliferation, and EMT induction, highlighting its tumor-suppressive role in this cancer type .
SRCIN1 has also been investigated in other cancer types, with varying roles observed:
Breast cancer: SRCIN1 functions as a tumor suppressor, strongly impairing breast cancer cell growth
Osteosarcoma: SRCIN1 enhances E-cadherin expression and suppresses osteosarcoma cell growth
These diverse roles across different cancer types underscore the context-dependent nature of SRCIN1 function and highlight the need for comprehensive studies using reliable SRCIN1 antibodies for accurate characterization.
Commercial SRCIN1 antibodies are generated against various regions of the SRCIN1 protein. For example:
Sigma-Aldrich HPA009701: Immunogen sequence NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRR
NSJ Bioreagents RQ4950: Amino acids E189-E287 from the human protein
Knowledge of the specific epitope recognized by an antibody is important for experimental design, particularly when studying protein domains, post-translational modifications, or protein-protein interactions involving SRCIN1.
SRCIN1 antibodies have been utilized in various research applications to elucidate the protein's expression patterns, functional roles, and potential as a therapeutic target.
Immunohistochemistry using SRCIN1 antibodies has been instrumental in characterizing the expression patterns of SRCIN1 in normal and cancerous tissues. These analyses have revealed:
Differential expression across normal human tissues
Upregulation in colorectal cancer tissues and metastatic lymph nodes
Correlation between SRCIN1 expression and tumor progression
For example, in colorectal cancer studies, paraffin-embedded tissue sections were stained with SRCIN1 antibodies to assess protein expression. The results showed predominantly cytoplasmic staining in CRC cells, with stronger intensity compared to normal colorectal mucosa .
Western blotting with SRCIN1 antibodies has been used to quantify SRCIN1 protein levels in tissue samples and cell lines. This technique has enabled researchers to:
Compare SRCIN1 expression between normal and cancerous tissues
Assess SRCIN1 expression across different cancer cell lines
Confirm successful overexpression or knockdown of SRCIN1 in experimental studies
For instance, western blot analysis of matched normal colon and cancerous colon tissues revealed higher SRCIN1 expression in 70% of the cancerous specimens . Similarly, western blotting confirmed the expression of SRCIN1 in various colorectal cancer cell lines, including LS174T, SW1116, SW620, LoVo, SW480, CaCo, DLD1, and HT29 .
SRCIN1 antibodies have been essential tools in functional studies investigating the protein's role in cancer cell behavior. These studies typically involve:
Manipulating SRCIN1 expression (overexpression or knockdown)
Assessing the effects on cell proliferation, migration, invasion, and other phenotypes
Using SRCIN1 antibodies to confirm the success of expression manipulation
For example, in studies of NSCLC, SRCIN1 overexpression and knockdown were confirmed by western blotting with SRCIN1 antibodies before assessing the effects on cell proliferation and invasion . Similarly, in colorectal cancer studies, SRCIN1 antibodies were used to verify successful transfection with SRCIN1-siRNA before functional assays .
SRCIN1 shows variable expression across human tissues. Immunohistochemistry studies using tissue microarrays have revealed:
Strong cytoplasmic immunoreactivity (100%) in breast, cerebrum, liver, and skin tissues
Moderate to strong cytoplasmic expression (80%) in kidney, testis, and stomach
Lower expression (60%) in lung and minimal expression (20%) in pancreas
Negative expression in esophagus, ovary, prostate, and uterus
Notably, 80% of normal colorectal tissues show negative SRCIN1 expression, while 84% of colorectal cancer tissues and 100% of CRC metastatic lymph nodes exhibit positive SRCIN1 expression . In contrast, SRCIN1 is downregulated in non-small cell lung cancer (NSCLC) compared to adjacent normal tissues . This differential expression pattern underscores the context-dependent role of SRCIN1 in different cancer types.
SRCIN1 antibodies have been validated for multiple research applications:
Western blotting (WB): Effective for detecting SRCIN1 protein (approximately 140 kDa) in human cancer cell lines (T-47D, MDA-MB-453), rat and mouse brain tissue lysates
Immunohistochemistry (IHC-P): Successfully used on paraffin-embedded sections of human tissues (appendicitis, ovarian cancer, placenta, esophagus squamous cancer)
Immunocytochemistry (ICC): Applied to cultured cells to visualize cellular localization
Immunofluorescence (IF): Used to examine subcellular distribution
Flow Cytometry: Validated for cell surface expression analysis
Optimal antibody concentration varies by application, with typical working dilutions ranging from 0.5 μg/mL for Western blot to 1 μg/mL for immunohistochemistry .
When investigating SRCIN1's apparently contradictory functions across cancer types, consider these methodological approaches:
Comparative expression analysis: Perform systematic comparison of SRCIN1 expression across multiple cancer types using matched tumor and adjacent normal tissues. Western blotting analysis of 10 pairs of matched normal and cancerous colon tissue revealed higher SRCIN1 expression in 70% of tumor samples .
Context-specific signaling pathway analysis: Examine SRCIN1 interactions with different downstream effectors:
Functional validation through gene modulation: Use siRNA knockdown and overexpression experiments across different cell lines representing various cancer types. For example:
In CRC cells (LoVo, SW1116): SRCIN1 knockdown induced cell differentiation, increased E-cadherin expression, and caused G0/G1 cell cycle arrest
In NSCLC cells (A549, NCI-H1650): SRCIN1 overexpression suppressed proliferation, invasion, and EMT by regulating Slug, E-cadherin, Vimentin, and N-cadherin expression
Tissue microenvironment considerations: Examine SRCIN1 function in 3D culture systems that better recapitulate in vivo conditions, such as MDCK cysts as a structural model of renal tubules .
SRCIN1 localization to lipid rafts is critical for its signaling functions. When investigating this aspect:
Lipid raft isolation protocol optimization:
Antibody selection for lipid raft studies:
Use antibodies validated for detecting SRCIN1 in its native conformational state
Consider using non-denaturing conditions for some applications
Verify antibody specificity in fractionated samples
Mutant constructs as controls:
Co-localization studies:
Perform double immunofluorescence staining of SRCIN1 with established lipid raft markers
Use confocal microscopy with appropriate resolution for membrane microdomain visualization
Functional readouts:
SRCIN1 has been implicated in therapeutic sensitivity and resistance mechanisms:
Combination therapy experimental design:
In colorectal cancer models, SRCIN1 suppression enhanced sensitivity to 5-fluorouracil (5-FU) both in vitro and in vivo
For KRAS-G12C mutant cancers, Src inhibition overcame resistance to KRAS-targeted therapy
Design experiments combining SRCIN1 modulation with standard chemotherapeutics or targeted therapies
Resistance model development:
Mechanistic pathway analysis:
Use phospho-specific antibodies to detect activation status of SRCIN1-regulated pathways
Examine changes in EMT markers (E-cadherin, N-cadherin, Vimentin) in response to therapy with and without SRCIN1 modulation
Assess Wnt/β-catenin pathway activation, as SRCIN1 was shown to induce this pathway in colorectal cancer
In vivo validation protocols:
Ensuring antibody specificity is critical for reliable research outcomes:
Multi-method validation approach:
Cross-validate results using at least two different antibodies targeting distinct epitopes
Compare commercial antibodies with in-house validated reagents when possible
Verify antibody specificity across multiple cell lines and tissue types
Knockdown/knockout controls:
Recombinant protein controls:
Use purified recombinant SRCIN1 protein as a positive control
Perform peptide competition assays to confirm epitope specificity
Consider using tagged recombinant SRCIN1 for dual detection strategies
Application-specific validation:
For IHC: Include multiple tissue types known to express or lack SRCIN1
For WB: Confirm appropriate molecular weight (approximately 140 kDa)
For IP: Verify pull-down of known SRCIN1 interaction partners
Cross-species reactivity assessment:
Several microRNAs have been shown to regulate SRCIN1 expression in cancer:
miRNA target validation techniques:
Luciferase reporter assays: Confirm direct targeting of SRCIN1 3'UTR
RNA immunoprecipitation (RIP) assays: Verify physical interaction between miRNAs and SRCIN1 mRNA
RNA pull-down assays: Confirm binding of specific miRNAs to SRCIN1
Expression correlation analysis:
Functional rescue experiments:
Pathway analysis downstream of miRNA-SRCIN1 interaction:
For optimal SRCIN1 detection, consider these application-specific protocols:
Western Blotting:
Use 5-20% SDS-PAGE gels for optimal separation of the 140 kDa SRCIN1 protein
Apply 50 μg of protein sample under reducing conditions
Run electrophoresis at 70V (stacking gel)/90V (resolving gel) for 2-3 hours
Transfer to nitrocellulose membrane at 150 mA for 50-90 minutes
Block with 5% non-fat milk in TBS for 1.5 hours at room temperature
Incubate with primary antibody at 0.5 μg/mL overnight at 4°C
Wash with TBS-0.1% Tween (3 times, 5 minutes each)
Incubate with HRP-conjugated secondary antibody (1:10000 dilution) for 1.5 hours at room temperature
Immunohistochemistry:
Perform heat-mediated antigen retrieval in citrate buffer (pH 6.0) for 20 minutes
Block tissue sections with 10% goat serum
Incubate with primary antibody at 1 μg/ml overnight at 4°C
Use biotinylated secondary antibody (30 minutes at 37°C)
Develop using Streptavidin-Biotin-Complex with DAB as chromogen
Cell Fractionation for Lipid Raft Analysis:
When encountering discrepancies in SRCIN1 detection:
Antibody validation across systems:
Verify antibody performance in your specific experimental system
Consider testing multiple antibodies targeting different epitopes
Assess potential cross-reactivity with related proteins
Technical optimization for specific tissues/cells:
Adjust lysis buffers for different tissue types (brain tissue may require different processing than epithelial tissues)
Optimize antigen retrieval methods for different fixation protocols
Consider native vs. denatured protein detection methods
Analysis of SRCIN1 isoforms and post-translational modifications:
Control for contextual protein expression:
Include positive and negative control samples in each experiment
Use recombinant SRCIN1 as a standard for quantitative comparisons
Document experimental conditions thoroughly to enable troubleshooting
The research demonstrates significant variation in SRCIN1 expression and function across tissue types and cancer contexts, so methodological consistency is crucial for reliable results .
SRCIN1 plays complex roles in cancer progression that can be investigated using the following approaches:
Multi-step cancer progression analysis:
Compare SRCIN1 expression across normal tissue, primary tumors, and metastatic lesions
In colorectal cancer, SRCIN1 was negative in 80% of normal tissues but positive in 84% of primary tumors and 100% of metastatic lymph nodes
Use tissue microarrays to assess SRCIN1 expression across large sample sets
Invasion and migration functional assays:
EMT marker analysis:
Signaling pathway activation markers:
In vivo metastasis models:
To investigate SRCIN1's impact on therapeutic responses: