SRPRB Antibody

What is SRPRB and why is it an important target for antibody-based research?

SRPRB (Signal Recognition Particle Receptor, B Subunit) is a transmembrane GTPase belonging to the GTPase superfamily that functions as a critical component in the protein trafficking machinery. It anchors the alpha subunit (a peripheral membrane GTPase) to the ER membrane and is essential for the cotranslational targeting of both secretory and membrane proteins to the ER membrane . SRPRB is also known as SR-beta or Protein APMCF1, with a calculated and observed molecular weight of 30 kDa . Research using SRPRB antibodies enables the study of fundamental cellular processes including protein translocation, secretory pathway dynamics, and ER membrane organization.

What are the key characteristics of commercially available SRPRB antibodies?

Multiple SRPRB antibodies are available for research applications, each with distinct characteristics:

*HPA011173 immunogen sequence: LCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTL

Most available SRPRB antibodies are rabbit polyclonal antibodies, which offer advantages for detecting native proteins in multiple applications but may show lot-to-lot variation.

What cell types and tissues are optimal for studying SRPRB expression?

Based on validation data, specific cell lines and tissues show reliable SRPRB expression and can serve as positive controls:

Human Cell Lines:

• HeLa cells

• HepG2 cells

• MCF-7 cells

• COLO 320 cells

• 293T cells

• Jurkat cells

Human Tissues:

• Liver tissue

• Breast cancer tissue

Other Species:

• Mouse liver tissue

• Mouse brain tissue

• Rat liver tissue

When designing experiments to study SRPRB, these validated sources provide reliable positive controls to ensure antibody functionality.

How should researchers validate SRPRB antibodies before implementing them in critical experiments?

Proper validation is essential for ensuring reliable experimental outcomes. The "antibody characterization crisis" highlighted in recent literature emphasizes the importance of thorough validation . For SRPRB antibodies, implement this multi-stage validation approach:

• Review existing validation data:

  • Examine vendor-provided Western blot images showing the expected 30 kDa band

  • Review immunohistochemistry data showing proper subcellular localization

  • Check citation records for previous successful applications

• Perform independent validation:

  • Positive control testing: Use known SRPRB-expressing samples (e.g., HepG2 cells, liver tissue)

  • Negative controls: Include samples without primary antibody

  • Specificity controls: If available, test with SRPRB knockdown/knockout samples

• Cross-application validation:

  • If using for multiple applications (e.g., WB and IHC), validate in each application separately

  • Compare results across different detection methods

• Documentation:

  • Maintain detailed records of all validation experiments

  • Include validation data in publications to support reproducibility

This systematic approach aligns with recent recommendations for improving antibody reproducibility in biomedical research .

What controls are essential when working with SRPRB antibodies?

Implementing appropriate controls is critical for generating reliable and interpretable data:

• Positive Controls:

  • Tissue samples: Human liver tissue, mouse brain tissue

  • Cell lines: HepG2, HeLa, MCF-7, COLO 320 cells

  • Recombinant protein: Purified SRPRB protein (if available)

• Negative Controls:

  • Primary antibody omission: Confirms secondary antibody specificity

  • Isotype control: Rabbit IgG at matching concentration

  • SRPRB-depleted samples: siRNA knockdown or CRISPR knockout (ideal but challenging)

• Technical Controls:

  • Loading controls: For Western blot (β-actin, GAPDH, etc.)

  • Blocking peptide competition: To verify epitope specificity

  • Multiple antibodies: Using antibodies targeting different SRPRB epitopes

• Procedural Controls:

  • Titration series: Testing multiple antibody dilutions to optimize signal-to-noise ratio

  • Incubation time variables: Testing different primary antibody incubation conditions

By systematically implementing these controls, researchers can significantly enhance data reliability and address potential artifacts or non-specific binding issues.

What are the optimal protocols for Western blotting with SRPRB antibodies?

Based on multiple validated protocols, here are the optimized conditions for Western blotting with SRPRB antibodies:

Detailed Protocol:

• Prepare cell/tissue lysates in RIPA buffer containing protease inhibitors

• Quantify protein using Bradford or BCA assay

• Load 40 μg of protein per lane on an 8% SDS-PAGE gel

• Transfer proteins to PVDF or nitrocellulose membrane (100V for 1 hour or 30V overnight)

• Block with 5% non-fat milk in TBST for 1 hour at room temperature

• Incubate with SRPRB antibody at optimal dilution (1:500-1:2000) overnight at 4°C

• Wash 3 times with TBST, 5 minutes each

• Incubate with HRP-conjugated anti-rabbit secondary antibody (1:8000) for 1 hour at room temperature

• Wash 3 times with TBST, 5 minutes each

• Develop using ECL substrate and image according to laboratory protocols

Human liver tissue, HepG2 cells, and HeLa cells have been validated as reliable positive controls that consistently show the expected 30 kDa band .

How should researchers optimize immunohistochemistry protocols for SRPRB antibodies?

Immunohistochemistry with SRPRB antibodies requires specific optimization:

Optimized Protocol:

• Deparaffinize and rehydrate 4-5 μm tissue sections

• Perform heat-mediated antigen retrieval using Tris-EDTA buffer (pH 9.0) for 20 minutes

• Cool sections to room temperature (approximately 20 minutes)

• Block endogenous peroxidase with 3% H₂O₂ for 10 minutes

• Block non-specific binding with 5% normal goat serum for 1 hour

• Incubate with SRPRB antibody at appropriate dilution overnight at 4°C

• Wash with PBS (3 times, 5 minutes each)

• Apply HRP-conjugated secondary antibody for 1 hour at room temperature

• Wash with PBS (3 times, 5 minutes each)

• Develop with DAB substrate until optimal signal intensity (typically 2-5 minutes)

• Counterstain with hematoxylin, dehydrate, and mount

It's important to note that antigen retrieval with Tris-EDTA buffer (pH 9.0) is specifically recommended for SRPRB antibodies, though citrate buffer (pH 6.0) can serve as an alternative .

What are the best approaches for immunofluorescence using SRPRB antibodies?

Immunofluorescence allows visualization of SRPRB's subcellular localization, particularly in the ER membrane:

Optimization Considerations:

• Test multiple antibody concentrations to determine optimal signal-to-noise ratio

• Consider alternative fixation methods if standard PFA fixation yields suboptimal results

• When studying SRPRB's role in protein trafficking, co-staining with ER markers (e.g., calnexin) is recommended

• For co-localization studies with secretory pathway components, confocal microscopy provides the necessary resolution

When interpreting results, remember that SRPRB localizes primarily to the ER membrane, with characteristic perinuclear and reticular staining patterns.

Why might Western blotting with SRPRB antibodies yield unexpected results?

When Western blotting with SRPRB antibodies produces unexpected results, consider these common issues and solutions:

Problem: No band or weak signal

• Causes: Low SRPRB expression, protein degradation, insufficient protein loading, suboptimal antibody dilution

• Solutions:

  • Increase protein loading to 40 μg per lane as validated in protocols

  • Use positive control samples (HepG2, HeLa cells)

  • Decrease antibody dilution (start with 1:500)

  • Use fresh samples and add protease inhibitors during sample preparation

  • Extend primary antibody incubation time (overnight at 4°C)

Problem: Multiple bands or bands at unexpected molecular weights

• Causes: Non-specific binding, protein degradation, post-translational modifications, splice variants

• Solutions:

  • Optimize blocking conditions (try 5% BSA instead of milk)

  • Increase washing frequency and duration

  • Test alternative SRPRB antibodies targeting different epitopes

  • Verify with another detection method (e.g., immunoprecipitation)

  • Remember that the expected molecular weight of SRPRB is 30 kDa

Problem: High background

• Causes: Insufficient blocking, excessive antibody concentration, inadequate washing

• Solutions:

  • Increase blocking time (2 hours at room temperature)

  • Dilute antibody further (try 1:1000-1:2000 range)

  • Add 0.05% Tween-20 to washing buffer

  • Extend washing steps (5 washes, 5 minutes each)

Problem: Inconsistent results between experiments

• Causes: Antibody degradation, protocol variations, sample quality differences

• Solutions:

  • Store antibodies according to manufacturer specifications (typically -20°C)

  • Standardize protocols with detailed documentation

  • Use the same lot of antibody when possible

  • Include positive controls in each experiment

How can researchers address issues with immunohistochemistry using SRPRB antibodies?

Immunohistochemistry with SRPRB antibodies can present specific challenges:

Problem: Weak or absent staining

• Causes: Inadequate antigen retrieval, suboptimal antibody dilution, fixation issues

• Solutions:

  • Prioritize Tris-EDTA buffer (pH 9.0) for antigen retrieval as specifically recommended for SRPRB antibodies

  • Increase retrieval time to 20-30 minutes

  • Use lower antibody dilutions (1:50 instead of 1:200)

  • Extend primary antibody incubation (overnight at 4°C)

  • Verify tissue fixation protocols (overfixation can mask epitopes)

Problem: Non-specific or diffuse staining

• Causes: Excessive antibody concentration, inadequate blocking, cross-reactivity

• Solutions:

  • Optimize antibody dilution (try 1:100-1:500 range)

  • Extend blocking time and use 5% normal serum matching secondary antibody species

  • Add 0.1% Triton X-100 to blocking buffer to reduce hydrophobic interactions

  • Include appropriate negative controls (primary antibody omission)

  • Compare results with different SRPRB antibodies

Problem: Excessive background staining

• Causes: Endogenous peroxidase activity, non-specific binding, inadequate washing

• Solutions:

  • Optimize endogenous peroxidase blocking (3% H₂O₂, 10-15 minutes)

  • Add 0.1% Tween-20 to washing buffer

  • Increase number and duration of washes

  • Pre-absorb secondary antibody if non-specific binding persists

  • Use avidin-biotin blocking if a biotin-based detection system is employed

Problem: Edge effect or uneven staining

• Causes: Tissue drying, uneven reagent distribution

• Solutions:

  • Use humidity chamber for all incubation steps

  • Apply sufficient volume of antibody solution

  • Ensure tissue sections remain level during incubations

  • Consider automated staining platforms for consistency

How can SRPRB antibodies be used to study protein-protein interactions in the secretory pathway?

SRPRB's role in the secretory pathway involves multiple protein-protein interactions that can be studied using these methodological approaches:

• Co-immunoprecipitation (Co-IP):

  • Use SRPRB antibodies to precipitate native protein complexes

  • Optimize lysis conditions to preserve membrane protein interactions (consider digitonin or NP-40 instead of stronger detergents)

  • Analyze co-precipitated proteins by Western blot or mass spectrometry

  • Look for interactions with SRP, SRP receptor alpha subunit, and ribosomal components

• Proximity Ligation Assay (PLA):

  • Combine SRPRB antibody with antibodies against potential interacting partners

  • This method allows visualization and quantification of protein-protein interactions in situ

  • Particularly valuable for studying SRPRB interactions with translocon components

  • Requires careful antibody selection to ensure compatible species and isotypes

• Immunofluorescence co-localization:

  • Use SRPRB antibodies (such as HPA011173 at 0.25-2 μg/mL) in combination with antibodies against ER markers

  • Analyze co-localization patterns using confocal microscopy

  • Quantify co-localization using Pearson's or Mander's coefficients

  • Particularly useful for studying changes in SRPRB localization during ER stress

• FRET/FLIM analysis:

  • For advanced studies, combine fluorescently labeled SRPRB antibodies with labeled antibodies against potential interaction partners

  • Measure energy transfer to precisely analyze proximity (<10 nm) between proteins

  • Requires specialized equipment but provides quantitative spatial information

These methods can be particularly valuable for understanding how SRPRB coordinates cotranslational N-glycosylation, as indicated in research publications .

What methodological approaches can be used to study SRPRB's role in disease contexts?

SRPRB antibodies can be valuable tools for investigating potential roles in pathological conditions:

• Expression analysis in disease tissues:

  • Use immunohistochemistry with validated SRPRB antibodies (dilutions 1:50-1:500)

  • Compare SRPRB expression levels between normal and pathological tissues

  • Validated tissues include human liver and breast cancer tissue

  • Quantify changes using digital image analysis and appropriate statistical methods

• Cellular stress response studies:

  • Examine changes in SRPRB localization or expression during ER stress

  • Combine with markers of the unfolded protein response (UPR)

  • Western blot analysis can quantify expression changes (40 μg protein/lane, 1:500-1:2000 dilution)

• Protein trafficking defect analysis:

  • Use SRPRB antibodies to investigate abnormal protein localization in disease models

  • Combine with antibodies against secretory pathway client proteins

  • Compare trafficking efficiency across normal and disease states

• Animal model applications:

  • SRPRB antibodies show reactivity with mouse and rat samples

  • Can be used to study SRPRB in animal models of disease

  • Validated tissues include mouse liver, mouse brain, and rat liver

• Cell culture disease models:

  • Validate SRPRB antibody performance in disease-relevant cell lines

  • Combine with genetic manipulations (CRISPR, siRNA) to model disease states

  • Validated cell lines include HeLa, HepG2, MCF-7, and COLO 320

These methodological approaches provide a framework for investigating potential roles of SRPRB in pathological contexts related to protein trafficking and ER function.

How can recombinant antibody technologies enhance SRPRB research?

Recent advances in antibody technology are addressing the "antibody characterization crisis" highlighted in the literature and offer new opportunities for SRPRB research:

• Advantages of recombinant SRPRB antibodies:

  • Defined sequence ensuring reproducibility between batches

  • Elimination of animal-to-animal and batch-to-batch variation

  • Potential for sequence engineering to enhance specificity

  • Possibility of epitope tagging for specialized applications

• Relevant initiatives:

  • The Protein Capture Reagent Program (PCRP) and Affinomics initiatives aim to generate well-characterized recombinant antibodies

  • The NeuroMab approach demonstrates successful generation, characterization, and distribution of recombinant antibodies

  • While these initiatives haven't specifically targeted SRPRB, their methodologies could be applied

• Methodological considerations:

  • Sequence-defined recombinant antibodies allow precise epitope targeting

  • Consider generating recombinant antibodies against functional domains of SRPRB

  • Implement standardized validation using multiple techniques for each new antibody

• Implementation strategy:

  • Begin with established, validated polyclonal antibodies (14636-1-AP, HPA011173)

  • Complement with recombinant antibodies as they become available

  • Validate each new antibody against the established standards

The transition to recombinant antibody technologies represents an important advancement for improving reproducibility in SRPRB research.

What emerging analytical techniques can enhance the utility of SRPRB antibodies?

Emerging technologies offer new possibilities for SRPRB antibody applications:

• Advanced imaging approaches:

  • Super-resolution microscopy: Allows visualization of SRPRB's precise localization at the ER membrane beyond the diffraction limit

  • Expansion microscopy: Physically expands samples to improve resolution with standard microscopes

  • Correlative light and electron microscopy (CLEM): Combines immunofluorescence with ultrastructural analysis

  • Live-cell imaging: Using fluorescently-tagged antibody fragments to track SRPRB dynamics

• High-throughput screening technologies:

  • Tissue microarrays: Enable rapid screening of SRPRB expression across multiple tissues and disease states

  • Reverse phase protein arrays: Allow quantitative analysis of SRPRB across many samples simultaneously

  • Automated immunostaining platforms: Enhance reproducibility and throughput

• Single-cell analysis approaches:

  • Mass cytometry (CyTOF): Combines flow cytometry with mass spectrometry for high-parameter analysis

  • Single-cell Western blotting: Enables protein analysis at the individual cell level

  • Imaging mass cytometry: Provides spatial information combined with high-parameter analysis

• Computational approaches:

  • Machine learning for antibody binding prediction and optimization

  • Automated image analysis for quantification of staining patterns

  • The emerging field of computational antibody design could lead to SRPRB antibodies with enhanced specificity

These technologies will expand the research applications of SRPRB antibodies and provide deeper insights into SRPRB biology and function.