ST8SIA3 is a sialyltransferase enzyme that catalyzes the transfer of α2,8-linked sialic acid residues to terminal positions on glycoproteins and glycolipids. It is highly expressed in the brain (particularly the striatum) and testis, and is implicated in:
Synthesis of α2,8-di/trisialylated glycotopes on striatal proteins like dopamine receptors (D1R/D2R) and adenosine A2A receptors (A2AR) .
Regulation of protein-lipid raft interactions and receptor heteromerization in the striatum .
Promotion of glioblastoma cell proliferation, migration, and tumorigenesis via A2B5 antigen expression .
Immunogen Sequence: A synthetic peptide corresponding to residues WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA .
Validation:
ST8SIA3 antibodies have revealed critical insights into striatal function:
Knockout Mice Analysis:
Therapeutic Implications: ST8SIA3-mediated sialylation is a potential target for Parkinson’s disease and schizophrenia .
In glioblastoma multiforme (GBM), ST8SIA3 antibodies have demonstrated:
ST8SIA3 is a member of the glycosyltransferase 29 family that catalyzes the transfer of sialic acid from CMP-linked sialic acid donors onto terminal sialic acid of various acceptors through alpha-2,8-linkages. It plays a crucial role in the synthesis of di- and trisialylated terminal glycotopes in the brain, particularly in the striatum . The enzyme has been shown to transfer sialic acid to alpha-2,3-linked and alpha-2,8-linked sialic acid residues on N-linked oligosaccharides of glycoproteins and glycolipids . Its enzymatic activity is essential for proper neuronal development and synaptic plasticity, making it a significant target in neurobiology research .
ST8SIA3 shows variable expression across brain regions, with the highest levels detected in the striatum compared to other areas such as the hippocampus, cortex, and cerebellum . Immunofluorescence studies have demonstrated that ST8SIA3 is primarily expressed in NeuN-positive neurons but not in S100 beta-positive astrocytes or Iba1-positive glial cells . Outside the brain, ST8SIA3 has been reported in the testis and fetal liver . This region-specific expression pattern suggests specialized functions in striatal neurons.
ST8SIA3 antibodies are validated for multiple research applications including:
| Application | Common Uses | Recommended Dilutions |
|---|---|---|
| Western Blot (WB) | Protein expression analysis | Varies by antibody |
| ELISA | Quantitative detection | Varies by antibody |
| Immunohistochemistry (IHC) | Tissue localization | Varies by antibody |
| Immunocytochemistry (ICC) | Cellular localization | Varies by antibody |
| Flow Cytometry | Cell population analysis | Varies by antibody |
| Immunoprecipitation (IP) | Protein interaction studies | Varies by antibody |
Western Blot represents the most common application for ST8SIA3 antibodies . When selecting an antibody, researchers should verify its validation for their specific application and species of interest.
To ensure antibody specificity for ST8SIA3, researchers should implement multiple validation approaches:
Knockout Controls: Utilize tissues or cells from ST8SIA3-knockout models (e.g., St8sia3-KO mice) as negative controls. Immunoblotting analysis has shown that ST8SIA3 antibodies produce signals in various brain regions of wild-type mice but not in St8sia3-KO mice .
Glycan Microarrays: Validate antibody binding specificity using glycan microarrays that contain various sialylated structures. For example, the S2-566 antibody recognizes Neu5Acα2-8Neu5Acα2-3Gal structures, while the A2B5 antibody recognizes Neu5Acα2-8Neu5Acα2-8Neu5Ac structures .
Sialidase Treatment: Perform sialidase treatments to remove sialic acid residues. If the antibody is specific for sialylated ST8SIA3 substrates, the signal should diminish after sialidase treatment, as demonstrated in studies comparing St8sia3-KO and wild-type mice .
Recombinant Protein Controls: Use recombinant ST8SIA3 protein as a positive control, and compare with other sialyltransferase family members to ensure no cross-reactivity .
For successful immunohistochemical detection of ST8SIA3:
Fixation: Use 4% paraformaldehyde for optimal epitope preservation while maintaining tissue morphology.
Antigen Retrieval: Heat-induced epitope retrieval in citrate buffer (pH 6.0) or EDTA buffer (pH 9.0) enhances antibody binding.
Blocking: Implement thorough blocking with 5-10% normal serum from the same species as the secondary antibody, plus 0.1-0.3% Triton X-100 for membrane permeabilization.
Controls: Include both positive controls (striatal tissue sections where ST8SIA3 is enriched) and negative controls (either omitting primary antibody or using St8sia3-KO tissue) .
Detection: For co-localization studies, ST8SIA3 antibodies can be combined with neuronal markers like NeuN for double immunofluorescence staining .
Visualization: Both fluorescent and colorimetric detection methods work effectively, with brightfield methods sometimes providing better resolution of subcellular localization.
ST8SIA3-mediated sialylation significantly impacts GPCR function in the striatum through several mechanisms:
Protein Size Modification: Studies using St8sia3-KO mice have demonstrated that the apparent sizes of several striatum-enriched G-protein-coupled receptors (GPCRs), including adenosine A2A receptor (A2AR) and dopamine D1/D2 receptors (D1R and D2R), are smaller in knockout mice compared to wild-type mice .
Lipid Raft Distribution: The absence of ST8SIA3-mediated sialylation alters the distribution of these receptors in lipid rafts, which affects their signaling properties and interaction with other membrane components .
Receptor Interactions: ST8SIA3 deficiency modifies the interaction between D2R and A2AR, with locomotor activity assays revealing altered pharmacological responses of St8sia3-KO mice to drugs targeting these receptors .
Heteromer Formation: A greater population of D2R forms heteromers with A2AR in the striatum of St8sia3-KO mice, which has implications for drug development targeting basal ganglia diseases such as schizophrenia and Parkinson's disease .
These findings suggest that ST8SIA3-mediated sialylation serves as a post-translational regulatory mechanism for GPCR function and interaction in the striatum.
ST8SIA3 has been implicated in several neurological conditions:
Schizophrenia: While ST8SIA2 is a known schizophrenia-associated gene, ST8SIA3's role in modulating D2R and A2AR function suggests it may also contribute to schizophrenia pathophysiology .
Parkinson's Disease: The A2AR-D2R heteromer is an important drug target for Parkinson's disease, and ST8SIA3's regulation of this interaction positions it as a potential therapeutic target .
Alzheimer's Disease: Dysregulation of ST8SIA3 has been implicated in Alzheimer's disease, possibly through altered neural adhesion and synaptic function .
Brain Tumors: ST8SIA3 overexpression has been shown to increase cell proliferation, migration, and clonogenicity in vitro, as well as tumor growth when cells were intracranially implanted, suggesting a role in brain tumor progression .
Research into ST8SIA3's role in these disorders may provide new avenues for therapeutic intervention, particularly for conditions affecting the basal ganglia.
ST8SIA3 exhibits distinct substrate preferences and sialylation patterns compared to other sialyltransferases:
Substrate Specificity: ST8SIA3 preferentially transfers sialic acid to N-linked oligosaccharides of glycoproteins rather than glycosphingolipids . Among glycolipids, 2,3-sialylparagloboside serves as the best acceptor substrate .
Glycan Structures: ST8SIA3 primarily catalyzes the formation of di- and trisialylated terminal glycotopes (α2,8-diSia and α2,8-triSia units) but not longer polysialic acid chains .
Polysialylation Efficiency: In vitro analyses show that ST8SIA3 transfers polysialic acid (PSA) to neural cell adhesion molecule (NCAM) with lower efficiency than ST8SIA2 and ST8SIA4 .
Optimal Acceptors: The best acceptor substrates for ST8SIA3 include α-Neu5Ac-(2->8)-α-Neu5Ac-(2->3)-β-D-Gal-(1->4)-6S-D-GlcNAc and monosialyl and disialyl N-acetyllactosamines .
This distinct substrate and product profile makes ST8SIA3 particularly important for specific neural functions, especially in the striatum.
Researchers face several technical challenges when investigating ST8SIA3:
Antibody Cross-Reactivity: The high sequence similarity between sialyltransferase family members (ST8SIA3 shares 96% amino acid identity between mouse and human ) can lead to antibody cross-reactivity, necessitating careful validation.
Detection of Sialylated Products: The analysis of sialylated glycans requires specialized techniques such as mass spectrometry with MS2 and MS3 analysis to distinguish between isomeric disialylated glycotopes .
Functional Redundancy: Potential functional overlap with other sialyltransferases complicates phenotypic analysis of knockout models.
Region-Specific Effects: The enrichment of ST8SIA3 in specific brain regions like the striatum means that whole-brain analyses may dilute regional effects, requiring precise microdissection techniques.
Post-Translational Regulation: ST8SIA3 undergoes post-translational modifications including glycosylation , which can affect its activity and complicate interpretation of expression studies.
ST8SIA3 antibodies are valuable tools for brain tumor research in several contexts:
Tumor Marker Detection: A2B5 antibody recognizes antigens whose expression is driven by ST8SIA3 and has been linked to proliferation of glioblastoma cells, suggesting potential use as a prognostic marker .
Cancer Stem Cell Identification: ST8SIA3-mediated glycans may serve as markers for isolating and characterizing cancer stem cell populations in brain tumors.
Therapeutic Target Validation: Antibodies can help validate ST8SIA3 as a therapeutic target by confirming its expression in patient samples and correlating with clinical outcomes.
Drug Response Prediction: Expression levels of ST8SIA3 determined using antibody-based methods might predict response to specific treatments targeting sialylation-dependent pathways.
These applications highlight the significance of ST8SIA3 antibodies in translational cancer research beyond their traditional use in basic neuroscience.
To accurately quantify ST8SIA3-mediated sialylation:
Mass Spectrometry: Utilize tandem mass spectrometry (MS2 and MS3) for detailed structural analysis and quantification of sialylated glycans. The summing of diagnostic MS3 ion intensity provides a reliable quantitative index for disialylated glycotopes .
Antibody-Based Detection: Use antibodies with defined specificity for different sialylated structures:
Enzyme Activity Assays: Measure ST8SIA3 enzyme activity using fluorescently labeled acceptor substrates and high-performance liquid chromatography (HPLC) or capillary electrophoresis.
Quantitative Western Blotting: Implement standardized protocols for quantifying ST8SIA3 protein levels and its sialylated targets, including appropriate normalization controls.
Glycan Microarray Analysis: Use glycan microarrays to profile the binding specificity of antibodies against different sialylated structures, enabling more precise interpretation of immunoblotting results .