STK32B Antibody

Shipped with Ice Packs
In Stock

Product Specs

Buffer
The antibody is supplied in phosphate-buffered saline (PBS) containing 0.02% sodium azide, 50% glycerol, pH 7.3. Store at -20°C. Avoid repeated freeze-thaw cycles.
Lead Time
We are typically able to ship your order within 1-3 business days of receipt. Delivery times may vary based on the method of purchase or location. For specific delivery estimates, please contact your local distributor.
Synonyms
2510009F08Rik antibody; gene for serine/threonine protein kinase antibody; HSA250839 antibody; PRO9744 antibody; Serine/threonine kinase 32B antibody; Serine/threonine-protein kinase 32B antibody; ST32B_HUMAN antibody; STK32 antibody; STK32B antibody; STKG6 antibody; UNQ3003 antibody; YANK 2 antibody; YANK2 antibody; Yet another novel kinase 2 antibody
Target Names
STK32B
Uniprot No.

Q&A

What is STK32B and what is its biological function?

STK32B (serine/threonine kinase 32B) is a 414 amino acid protein that contains one protein kinase domain and belongs to the Ser/Thr protein kinase family. Using magnesium as a cofactor, STK32B (also known as YANK2) functions to catalyze the ATP-dependent phosphorylation of target proteins and plays a significant role in various intracellular signaling events throughout the cell. Multiple isoforms of STK32B exist due to alternative splicing events . The protein is encoded by the STK32B gene in humans and has various synonyms in the literature including HSA250839, STK32, STKG6, and YANK2 . As a member of the serine/threonine kinase family, STK32B is implicated in signal transduction pathways that regulate various cellular processes, although its specific downstream targets and precise biological roles are still being elucidated through ongoing research.

What types of STK32B antibodies are available for research applications?

The primary types of STK32B antibodies available for research include rabbit polyclonal antibodies that target human STK32B. These antibodies are typically generated using synthetic peptides derived from human STK32B sequences as immunogens . For instance, several manufacturers offer affinity-isolated antibodies that have been extensively validated for specific applications. The antibodies are generally available in unconjugated forms, stored in buffered aqueous glycerol solutions or similar storage buffers containing preservatives like sodium azide . Some products, such as Prestige Antibodies, undergo extensive characterization and validation processes, including testing on tissue arrays and protein arrays to ensure specificity and minimal cross-reactivity .

What are the recommended applications for STK32B antibodies?

Based on the available literature and manufacturer specifications, STK32B antibodies have been validated for several research applications:

ApplicationRecommended Dilution/ConcentrationNotes
Immunofluorescence (IF)0.25-2 μg/mLUseful for cellular localization studies
Enzyme-Linked Immunosorbent Assay (ELISA)1:2000-1:5000Effective for quantification studies
Immunohistochemistry (IHC)1:25-1:100Suitable for tissue expression analysis

When designing experiments, researchers should optimize these recommended dilutions for their specific experimental conditions, including sample type, detection method, and visualization system. Validation using positive and negative controls is essential to ensure reliable results across different experimental settings .

How can mass spectrometry be used to identify STK32B antibodies in a polyclonal response?

Mass spectrometry-based approaches offer powerful methods for identifying and characterizing antibodies, including those against STK32B, within a polyclonal response. The methodology involves several key steps:

  • Pepsin digestion of serum IgGs to generate F(ab)₂ fragments

  • Antigen-affinity chromatography to isolate target-specific antibodies

  • Bottom-up liquid chromatography–high-resolution tandem mass spectrometry (LC-MS/MS) analysis of elution, wash, and flow-through fractions

  • Database comparison using NextGen sequencing of mature B cells to create a reference database of IgG variable gene (V-gene) sequences

This process is particularly challenging for antibodies due to their high sequence diversity, especially in complementarity determining regions (CDRs). The identification typically focuses on mapping peptides marking unique VH CDRH3 sequences, which represent the most variable antibody regions. For comprehensive coverage, multiple replicate injections using long, shallow LC gradients are recommended, generating >100,000 MS2 fragmentation spectra per sample. Peptides found to be enriched >10-fold in the elution fraction compared to wash and flow-through fractions are considered to correspond to IgGs with high antigen specificity .

What approaches can be used to validate the specificity of STK32B antibodies?

Validating antibody specificity is crucial for ensuring reliable experimental results. For STK32B antibodies, several complementary approaches are recommended:

  • Western Blotting with Control Lysates: Test antibodies against lysates from cells known to express or not express STK32B, or use lysates from STK32B-knockdown cells compared to control cells.

  • Immunoprecipitation Combined with Mass Spectrometry: Perform immunoprecipitation with the STK32B antibody followed by mass spectrometric analysis to confirm that STK32B is indeed the captured protein.

  • Protein Arrays: Test against arrays containing multiple human recombinant protein fragments to assess cross-reactivity. Some commercial STK32B antibodies have been validated against arrays of 364 human recombinant protein fragments .

  • Tissue Arrays: Validate expression patterns using immunohistochemistry on tissue arrays containing multiple normal human tissues and cancer tissues. This approach helps confirm that the observed staining patterns align with known STK32B expression profiles .

  • Peptide Competition Assays: Pre-incubate the antibody with the immunizing peptide before application to the sample. Specific signals should be significantly reduced or eliminated.

These validation approaches should be performed under conditions as similar as possible to the intended experimental application to ensure relevant results.

What are the optimal storage conditions for maintaining STK32B antibody activity?

To maintain STK32B antibody activity and stability over time, proper storage conditions are essential:

  • Temperature: Store antibodies at -20°C for long-term storage. Some products may be maintained at 4°C for short periods but avoid repeated freeze-thaw cycles .

  • Buffer Composition: Most STK32B antibodies are supplied in buffered solutions (typically PBS) containing stabilizers such as glycerol (40-50%) and preservatives like sodium azide (0.05%). The pH is usually maintained around 7.3-7.4 .

  • Aliquoting: Upon receipt, aliquot the antibody into smaller volumes based on typical experimental usage to minimize freeze-thaw cycles. Each freeze-thaw cycle can decrease antibody activity by 10-15%.

  • Handling: When removing from storage, thaw antibodies on ice and centrifuge briefly to collect the solution at the bottom of the tube. Avoid vortexing, which can cause aggregation.

  • Shipping Conditions: Most STK32B antibodies are shipped at 4°C and should be stored immediately upon receipt according to manufacturer recommendations .

Proper documentation of storage conditions, freeze-thaw cycles, and antibody performance over time can help identify any stability issues and ensure experimental reproducibility.

How can cross-reactivity issues with STK32B antibodies be minimized in multi-species studies?

Cross-reactivity can significantly impact the reliability of experimental results, particularly in multi-species studies. To minimize these issues with STK32B antibodies:

  • Careful Antibody Selection: Choose antibodies raised against epitopes that are highly conserved across the species of interest. Most commercial STK32B antibodies are raised against human sequences and may have limited cross-reactivity with other species .

  • Epitope Analysis: Analyze the immunogen sequence used to generate the antibody and compare sequence homology across target species. For example, if using a human STK32B antibody (immunogen sequence: LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV) for rat studies, verify the sequence conservation between human and rat STK32B .

  • Validation in Each Species: Validate the antibody separately in each species of interest using appropriate positive and negative controls before conducting comparative studies.

  • Blocking Strategies: Implement more stringent blocking protocols using species-specific serum or BSA to reduce non-specific binding.

  • Secondary Antibody Selection: Choose secondary antibodies with minimal cross-reactivity to other species' immunoglobulins, and consider using secondary antibodies pre-adsorbed against the non-target species.

  • Controls: Include isotype controls and samples from STK32B-deficient tissues or cells from each species to confirm specificity across all experimental conditions.

By implementing these strategies, researchers can increase confidence in the specificity of their STK32B antibody across multiple species, ensuring more reliable comparative data.

How can STK32B expression data from IHC studies be properly quantified and normalized?

Quantification and normalization of STK32B expression data from immunohistochemistry studies require systematic approaches to ensure accuracy and reproducibility:

  • Digital Image Analysis: Utilize specialized software (ImageJ, QuPath, etc.) to quantify staining intensity and distribution. Parameters should include:

    • Percentage of positively stained cells

    • Staining intensity scores (0=negative, 1=weak, 2=moderate, 3=strong)

    • Calculation of H-scores (H = Σ [percentage of cells with intensity i] × i), where i ranges from 0-3

  • Standardized Scoring System: Implement a standardized scoring system such as the Immunoreactive Score (IRS) which combines staining intensity and percentage of positive cells:

    • IRS = SI (staining intensity) × PP (percentage of positive cells)

    • SI: 0=negative, 1=weak, 2=moderate, 3=strong

    • PP: 0=0%, 1=<10%, 2=10-50%, 3=51-80%, 4=>80%

  • Internal Controls: Include internal positive controls (tissues known to express STK32B) and negative controls (primary antibody omitted) in each experimental batch to normalize between experiments.

  • Normalization Strategies:

    • Normalize to housekeeping proteins in parallel sections

    • Use tissue microarrays to minimize batch variation

    • Employ automated staining platforms to reduce technical variability

  • Observer Variation Control: Have multiple trained observers score samples independently and calculate inter-observer agreement (kappa statistic).

By implementing these quantification and normalization strategies, researchers can generate more reliable and comparable data on STK32B expression across different tissues, experimental conditions, or patient samples .

What are the known chemical interactions that affect STK32B expression, and how should these be accounted for in experimental design?

Several chemicals have been documented to modulate STK32B expression, which is critical information for experimental design:

ChemicalEffect on STK32BEvidence TypeExperimental Consideration
1,1-dichloroetheneDecreases expressionInferred from orthologyPotential confounder in toxicology studies
1-naphthyl isothiocyanateIncreases expressionExperimentalConsider as positive control for expression studies
2,3,7,8-tetrachlorodibenzodioxineAffects expressionInferred from orthologyMonitor in environmental exposure models
4,4'-diaminodiphenylmethaneIncreases expressionInferred from orthologyAccount for in toxicological investigations
6-propyl-2-thiouracilIncreases expressionExperimentalConsider impact in thyroid-related studies
AcrylamideDecreases expressionExperimentalControl exposure in neurological models
Aflatoxin B1Decreases methylationInferred from human dataConsider epigenetic impacts
All-trans-retinoic acidDecreases expressionInferred from human dataFactor into developmental studies
Arsenite(3-)Interferes with G3BP1 binding to STK32B mRNAInferred from human dataImportant for stress granule research

When designing experiments involving STK32B, researchers should:

  • Document Exposure: Record any exposure to these chemicals in experimental subjects or cell cultures.

  • Implement Controls: Include appropriate controls to account for chemical-induced changes in STK32B expression.

  • Temporal Considerations: Monitor the timing of chemical exposure relative to experimental measurements, as expression changes may be time-dependent.

  • Dose-Response Relationships: Establish dose-response relationships for chemicals known to affect STK32B to determine threshold levels for significant effects.

  • Epigenetic Analysis: Consider incorporating methylation analysis when working with agents like aflatoxins that affect STK32B methylation.

By accounting for these chemical interactions, researchers can design more robust experiments and more accurately interpret results related to STK32B expression and function .

How can STK32B antibodies be utilized in studying intracellular signaling pathways?

STK32B antibodies can serve as valuable tools for investigating intracellular signaling pathways through several methodological approaches:

  • Phosphorylation State Analysis: Use phospho-specific STK32B antibodies to monitor activation states in response to various stimuli, helping to position STK32B within signaling cascades.

  • Co-Immunoprecipitation Studies: Employ STK32B antibodies for co-IP experiments to identify binding partners and protein complexes, revealing functional relationships within signaling networks.

  • Proximity Ligation Assays (PLA): Combine STK32B antibodies with antibodies against suspected interaction partners to visualize protein-protein interactions in situ with subcellular resolution.

  • ChIP-Seq Applications: Use STK32B antibodies in chromatin immunoprecipitation followed by sequencing to identify potential roles in transcriptional regulation if nuclear localization is observed.

  • Multiplex Immunofluorescence: Combine STK32B antibodies with markers of specific signaling pathways in multiplex immunofluorescence to correlate STK32B expression or localization with pathway activation states.

The serine/threonine kinase function of STK32B suggests its involvement in phosphorylation cascades that regulate cellular processes. By strategically applying STK32B antibodies in these methodologies, researchers can map its position and function within complex signaling networks that may be relevant to normal physiology and disease states .

What considerations are important when using STK32B antibodies in studies of alternative splicing variants?

When investigating STK32B alternative splicing variants, several methodological considerations are critical for obtaining valid and interpretable results:

  • Epitope Mapping: Determine the exact epitope recognized by the antibody and verify whether it is present in all known splicing variants. The immunogen sequence used for antibody generation (e.g., LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV) should be aligned with all known variant sequences .

  • Isoform-Specific Detection: For discriminating between isoforms:

    • Use antibodies raised against unique junction sequences or exon-specific regions

    • Complement antibody studies with RT-PCR using isoform-specific primers

    • Consider using Western blotting to distinguish variants by molecular weight differences

  • Expression Validation: Validate expression patterns of different isoforms by correlating protein detection (using antibodies) with mRNA expression data (using RT-qPCR or RNA-seq).

  • Controls: Include positive controls expressing known STK32B isoforms and negative controls where specific isoforms are knocked down.

  • Alternative Approaches:

    • Consider expressing tagged recombinant isoforms for functional studies if antibodies cannot distinguish between closely related variants

    • Use mass spectrometry-based proteomics to identify isoform-specific peptides

  • Functional Differences: Design experiments to determine whether different isoforms have distinct:

    • Subcellular localizations

    • Binding partners

    • Kinase activities

    • Responses to regulatory signals

Multiple isoforms of STK32B exist due to alternative splicing events, which may confer different functional properties or regulatory mechanisms. Careful antibody selection and complementary molecular techniques are essential for accurately characterizing these variants and their distinct biological roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.