SWT1 (SWT1 RNA endoribonuclease homolog) is encoded by the C1orf26 gene in humans. It is a 103.2 kDa nuclear protein implicated in RNA metabolism and transcriptional regulation .
| Property | Detail |
|---|---|
| Gene ID | 54823 |
| Molecular Weight | 103.222 kDa |
| Amino Acid Sequence | ALTTSNIASFEEAFICLQKLMAAVRDILEGIQRILAPNSDYQDVETLYNFLIKYEVNKNVKFTAQEIYDCVSQTEYREKLTIGC |
| Species Reactivity | Human, Mouse, Rat |
Sample Types: Human SH-SY5Y, K562, Jurkat, and U251 cell lysates; rodent testis and NIH/3T3 lysates .
Conditions:
Protocol: Fixed/permeabilized K562 cells stained with A15590 (1 µg/10⁶ cells) and DyLight®488 secondary antibody.
Outcome: Distinct intracellular staining vs. isotype controls .
Sigma-Aldrich’s HPA027334 antibody detects SWT1 in formalin-fixed tissues at 1:200–1:500 dilutions .
SWT1 antibodies enable:
Transcriptional Regulation Studies: Mapping SWT1’s role in RNA processing via WB and immunofluorescence .
Cancer Research: Profiling SWT1 expression in leukemia (K562, Jurkat) and neuroblastoma (SH-SY5Y) models .
Cross-Species Analysis: Detecting conserved epitopes in human, mouse, and rat tissues .
Storage: Lyophilized antibodies (e.g., A15590) are stable at -20°C for 1 year; reconstituted aliquots last 6 months at -20°C .
Buffer Compatibility: Liquid formulations (e.g., HPA027334) use PBS with glycerol (pH 7.5) .
Controls: Include isotype-matched antibodies and antigen-blocking peptides for validation .
Recent studies focus on SWT1’s interactions with RNA polymerase II and its potential role in neurodegenerative diseases . Antibodies like A15590 and HPA027334 are critical tools for these investigations.
KEGG: sce:YOR166C
STRING: 4932.YOR166C
SWT1 (Transcriptional protein SWT1, also known as C1orf26) is a protein involved in transcriptional regulation. It has been identified as a potential target for research due to its endogenous expression in human and mouse tissues . The protein is encoded by the SWT1 gene (Gene ID: 54823) and is referenced in the UniProt database as SWT1_HUMAN . Research involving SWT1 antibodies allows scientists to study the protein's expression patterns, cellular localization, and potential roles in biological processes through various immunological techniques.
Based on the available research tools, SWT1 antibodies are primarily available as rabbit polyclonal antibodies that have been affinity-purified from rabbit antiserum using epitope-specific immunogens . These antibodies are specifically designed to detect endogenous levels of the SWT1 protein (C1orf26) in human and mouse samples . The antibodies are typically unconjugated, belonging to the IgG isotype, and are suitable for western blotting applications.
SWT1 antibodies should be stored at -20°C for up to one year from the date of receipt . It is critical to avoid repeated freeze-thaw cycles as these can compromise antibody stability and performance. The antibodies are typically supplied in a liquid formulation containing PBS with 50% glycerol, 0.5% BSA, and 0.02% sodium azide as preservatives . This formulation helps maintain antibody stability during storage while preventing microbial contamination.
For Western blotting applications, the recommended dilution range for SWT1 antibodies is 1:500 to 1:2000 . The optimal dilution may vary depending on the specific experimental conditions, including the abundance of the target protein in your samples, the detection system used, and the sensitivity requirements of your experiment. It is advisable to perform a dilution series during initial optimization to determine the optimal antibody concentration for your specific application.
Antibody specificity is crucial when detecting SWT1 in complex biological samples. The specificity of an SWT1 antibody is determined by the epitope used for immunization and the subsequent affinity purification process. As with other polyclonal antibodies, SWT1 antibodies are produced by immunizing rabbits with synthesized peptides derived from human C1orf26 . The specificity can be influenced by various factors similar to those affecting other research antibodies, including potential cross-reactivity with structurally similar proteins, post-translational modifications, and protein conformational states.
When working with complex biological samples, researchers should validate specificity through approaches similar to those used for other antibodies:
Positive and negative control samples with known SWT1 expression profiles
siRNA or CRISPR knockdown validation
Recombinant protein blocking experiments
Multiple antibodies targeting different epitopes of the same protein
These validation strategies help ensure that experimental observations reflect genuine SWT1 detection rather than non-specific binding or cross-reactivity with other proteins.
Longitudinal studies using SWT1 antibodies require careful attention to factors that could affect reproducibility. Drawing from research on antibody stability patterns, several critical considerations emerge:
Lot-to-lot variability: Polyclonal antibody preparations can vary between production lots. Purchase sufficient quantities from the same lot for longitudinal studies.
Antibody storage conditions: Improper storage can lead to degradation. As with other antibodies, SWT1 antibodies should be aliquoted upon receipt to minimize freeze-thaw cycles and stored at -20°C .
Consistent experimental protocols: Standardize sample preparation, blocking conditions, antibody dilutions, incubation times, and detection methods.
Internal controls: Include consistent positive and negative controls across experimental timepoints to normalize for technical variations.
Sample handling consistency: Variations in sample collection, processing, and storage can affect protein epitope accessibility and recognition.
Similar to patterns observed in longitudinal antibody studies for other targets , researchers should monitor signal intensity over time and assess potential antibody performance drift through regular calibration with reference samples.
When encountering weak or absent signals with SWT1 antibodies, a systematic troubleshooting approach is recommended, drawing on principles established for other antibody applications:
Similar to approaches used with other challenging antibodies, optimizing the signal-to-noise ratio may require adjusting multiple parameters simultaneously while maintaining appropriate controls to validate the specificity of any detected signals.
Validating SWT1 antibody specificity for novel applications requires a comprehensive set of controls, drawing on established antibody validation principles:
Positive tissue/cell controls: Include samples known to express SWT1 at detectable levels based on other methods (e.g., RNA-seq, proteomics data).
Negative controls: Include samples where SWT1 expression is absent or significantly reduced.
Genetic knockdown/knockout controls: When feasible, use siRNA, shRNA, or CRISPR/Cas9 to reduce or eliminate SWT1 expression.
Blocking peptide controls: Pre-incubate antibody with excess immunizing peptide to demonstrate signal specificity.
Loading controls: Include housekeeping proteins to normalize for loading variations.
Secondary antibody-only controls: Omit primary antibody to assess background from secondary antibody.
Orthogonal method validation: Confirm findings using alternative techniques like mass spectrometry or mRNA analysis.
These controls help establish the specificity, sensitivity, and reliability of the SWT1 antibody in your experimental system, particularly important when exploring novel applications beyond the manufacturer's recommended western blotting use .
Optimizing SWT1 antibody concentration for different cell lines requires a methodical approach similar to antibody optimization for other targets:
Preliminary expression assessment: Before detailed optimization, confirm SWT1 expression in your cell lines through transcriptomic data or literature review.
Titration matrix: Prepare a matrix combining different protein amounts (5-50 μg) with various antibody dilutions across the recommended range (1:500-2000) .
Signal-to-noise evaluation: For each combination, calculate the ratio between specific signal and background to identify optimal conditions.
Cell line-specific considerations: Different cell lines may require specific lysis conditions to efficiently extract SWT1 protein due to varying subcellular localization or association with other cellular components.
Standardization approach: To compare SWT1 levels across cell lines, normalize signals to loading controls and include a common reference sample across blots.
The optimal antibody concentration may vary between cell lines due to differences in SWT1 expression levels, post-translational modifications, or matrix effects. Systematic optimization for each cell line ensures reliable and quantitative results.
Quantifying SWT1 protein expression via western blotting requires rigorous attention to methodology, similar to best practices established for other proteins:
Linear dynamic range determination: Establish the linear range of detection for both SWT1 and loading control antibodies by creating standard curves with serial dilutions of cell lysate.
Appropriate loading controls: Select loading controls that remain stable under your experimental conditions and have expression levels that won't saturate detection.
Consistent transfer efficiency monitoring: Use stain-free technology or total protein staining to verify uniform transfer across the membrane.
Image acquisition optimization: Capture images before signal saturation occurs; use equipment with a wide dynamic range.
Densitometry best practices:
Subtract local background for each band
Use identical measurement areas across samples
Normalize SWT1 band intensity to loading controls
Include technical and biological replicates
Statistical analysis: Apply appropriate statistical tests to determine the significance of observed differences.
Following these methodological approaches enhances the reliability and reproducibility of SWT1 protein quantification in western blotting experiments.
Non-specific bands are a common challenge when working with antibodies including SWT1 antibodies. Addressing this issue requires systematic investigation and optimization:
Characterize the pattern: Document the molecular weights and consistency of all observed bands across samples.
Optimize blocking conditions: Test different blocking agents (BSA, non-fat milk, commercial blockers) and concentrations to reduce non-specific binding.
Adjust antibody dilution: Non-specific binding often decreases at higher antibody dilutions; test the upper end of the recommended range (closer to 1:2000) .
Modify washing protocol: Increase the number, duration, or stringency of wash steps to remove weakly bound antibodies.
Alternative sample preparation: Test different lysis buffers, denaturation conditions, or protein extraction methods that may affect epitope accessibility and specificity.
Peptide competition: Perform a peptide competition assay where specific bands should disappear while non-specific bands remain.
Cross-validation: Compare band patterns using alternative SWT1 antibodies targeting different epitopes or using orthogonal methods like immunoprecipitation followed by mass spectrometry.
Careful documentation of these optimization steps creates a reliable protocol for specific SWT1 detection in your experimental system.
Improving inter-laboratory reproducibility of SWT1 antibody experiments requires standardization of multiple experimental parameters:
Detailed protocol sharing: Document all experimental parameters including buffer compositions, incubation times, temperatures, and equipment settings.
Antibody validation reporting: Share detailed antibody validation data, including lot numbers, dilution optimization experiments, and specificity controls.
Reference sample exchange: Distribute identical reference samples between laboratories to calibrate detection systems and normalize results.
Standard operating procedures (SOPs): Develop and follow detailed SOPs that specify each step of the experimental workflow.
Metadata documentation: Record and share all relevant metadata including cell passage number, growth conditions, and harvest protocols.
Blinded analysis: Implement blinded analysis procedures where possible to minimize unconscious bias.
Consistent data analysis pipelines: Use standardized image analysis and statistical approaches across laboratories.
Similar to reproducibility challenges observed with other antibodies , these approaches minimize technical variations while preserving the ability to detect genuine biological differences in SWT1 expression or modification.
Discrepancies between SWT1 protein levels (detected by antibodies) and mRNA expression data are not uncommon in protein research. When encountering such contradictions, consider the following analytical approach:
Technical validation:
Confirm SWT1 antibody specificity through additional controls
Verify primer specificity and efficiency for mRNA detection
Rule out sample degradation or processing artifacts
Biological explanations:
Post-transcriptional regulation (miRNAs, RNA-binding proteins)
Translational efficiency differences
Protein stability and turnover rates
Post-translational modifications affecting epitope recognition
Temporal considerations:
Time lag between transcription and translation
Different half-lives of mRNA versus protein
Sampling at different time points in dynamic processes
Spatial factors:
Subcellular protein localization affecting extraction efficiency
Translation occurring in different cellular compartments than transcription
Integrated analysis approach:
Perform time-course experiments to capture dynamics
Use multiple antibodies targeting different SWT1 epitopes
Implement parallel proteomics approaches for validation
Consider functional assays to determine biological relevance
Recognizing that mRNA and protein levels often don't perfectly correlate due to biological regulation allows for more nuanced interpretation of apparently contradictory results.
Epitope accessibility can significantly impact SWT1 antibody performance. Researchers can systematically evaluate and address this issue through several methodological approaches:
Structural analysis: If structural information is available for SWT1, analyze whether the target epitope is surface-exposed or potentially masked in the native protein conformation.
Multiple denaturation conditions: Compare native, partially denatured, and fully denatured sample preparations to determine optimal epitope exposure:
Native conditions: Non-denaturing detergents without reducing agents
Partial denaturation: Mild detergents with/without low concentrations of reducing agents
Full denaturation: Strong detergents (SDS) with high concentrations of reducing agents
Cross-linking experiments: Use membrane-permeable crosslinkers to determine if SWT1 forms complexes that might mask epitopes.
Post-translational modification analysis: Investigate whether phosphorylation, glycosylation, or other modifications affect epitope recognition using appropriate enzymes (phosphatases, glycosidases) before antibody application.
Alternative epitope antibodies: Compare results using antibodies targeting different epitopes of SWT1 to identify regions with consistent accessibility.
Similar to approaches used for other challenging protein targets, these methods can help distinguish between true biological variations in SWT1 expression and technical limitations related to epitope accessibility.
Designing multi-color immunofluorescence experiments that include SWT1 antibodies requires careful methodological planning:
Primary antibody compatibility:
Spectral considerations:
Choose fluorophores with minimal spectral overlap
Include single-stain controls for spectral unmixing if needed
Consider tissue autofluorescence characteristics when selecting fluorophores
Signal amplification strategy:
For low-abundance targets, consider tyramide signal amplification or similar methods
Balance amplification across targets to avoid overexposure of abundant proteins while detecting low-expression proteins
Epitope retrieval optimization:
Test multiple antigen retrieval methods to ensure compatibility with all antibodies
Optimize retrieval conditions to maximize signal while preserving tissue morphology
Validation controls:
Include absorption controls with immunizing peptides
Implement knock-down controls where feasible
Compare staining patterns with reported subcellular localization data
Image acquisition and analysis:
Use sequential scanning to minimize bleed-through
Implement consistent thresholding methods across experimental conditions
Consider colocalization analysis to assess protein interactions
These methodological considerations help ensure reliable and interpretable results in complex multi-color imaging experiments involving SWT1 antibodies.