TMEM132E Antibody

What is TMEM132E and why would researchers use antibodies targeting it?

TMEM132E (Transmembrane Protein 132E) is a single-pass type I membrane protein belonging to the TMEM132 family. As a membrane-associated protein, TMEM132E is primarily studied in contexts requiring identification of cellular membrane structures, protein localization analysis, and investigation of transmembrane protein function. Antibodies targeting this protein enable researchers to detect its expression in tissues and cells, study its subcellular localization, and investigate its potential roles in physiological and pathological processes. Current commercially available antibodies target different epitopes of this protein, allowing for comprehensive detection approaches .

What types of TMEM132E antibodies are currently available for research applications?

Several types of TMEM132E antibodies are available for research, each targeting different epitopes of the protein:

• C-terminal antibodies targeting amino acids 704-733

• Mid-region antibodies targeting amino acids 486-536

• Antibodies raised against specific immunogen sequences such as SHTILATTAAQQTLSFLKQEALLSLWLSYSDGTTAPLSLYSPRDYGLLVSSLDEHVATVTQDRAFPLVVAEAEGSGELL

These antibodies are predominantly rabbit polyclonal antibodies available in unconjugated form, though some vendors offer conjugated versions (APC, Biotin, FITC, PE, HRP) for specialized applications. Most are affinity-purified through protein A columns followed by peptide affinity purification to ensure specificity .

What applications are TMEM132E antibodies validated for?

TMEM132E antibodies have been validated for several key research applications:

Researchers should verify that their selected antibody has been specifically validated for their intended application, as performance may vary significantly between applications even for the same antibody .

What is known about the species reactivity of commercial TMEM132E antibodies?

Commercial TMEM132E antibodies demonstrate reactivity to:

• Human TMEM132E (most products)

• Mouse TMEM132E (select products)

• Rat TMEM132E (limited products)

It's essential to verify cross-reactivity for each specific antibody before use, particularly for comparative studies across species. The epitope sequence conservation between species should be considered when selecting antibodies for cross-species applications. Available product data sheets typically indicate validated species reactivity based on sequence homology and experimental validation .

What criteria should guide selection of the appropriate TMEM132E antibody for specific research applications?

Selection of the appropriate TMEM132E antibody should be based on:

• Target epitope location: Different antibodies recognize distinct regions of TMEM132E (C-terminal region AA 704-733, mid-region AA 486-536, etc.). Consider which domain is most relevant to your research question and whether it might be masked or cleaved under your experimental conditions .

• Validated applications: Verify the antibody has been specifically validated for your intended application. For example, antibodies performing well in Western blot may not necessarily work in immunohistochemistry .

• Species compatibility: Ensure the antibody recognizes TMEM132E in your experimental model organism. Check sequence homology of the epitope region between species .

• Clonality and format: All currently available TMEM132E antibodies appear to be polyclonal, which offers broader epitope recognition but potentially higher background. Consider conjugated versions for direct detection applications .

• Validation data: Review available images of Western blots, IHC staining patterns, and other validation data to assess performance quality .

What are optimal sample preparation conditions for detecting TMEM132E as a membrane protein?

For optimal detection of TMEM132E as a membrane protein:

• Tissue/cell lysis:

  • Use membrane protein-compatible lysis buffers containing 0.5-1% non-ionic detergents (NP-40, Triton X-100) or zwitterionic detergents (CHAPS)

  • Include protease inhibitor cocktails to prevent degradation

  • Maintain cold temperatures throughout processing

• Protein extraction considerations:

  • Consider membrane fractionation to enrich for TMEM132E

  • Avoid excessive heating of samples which may cause membrane protein aggregation

  • Sonication may help solubilize membrane proteins but should be optimized to prevent degradation

• Storage conditions:

  • Store antibodies at -20°C as recommended by manufacturers

  • Avoid repeated freeze-thaw cycles of both samples and antibodies

  • For long-term storage, aliquot antibodies to minimize freeze-thaw cycles

• Fixation for microscopy:

  • For immunohistochemistry, optimal fixation preserves membrane structure without masking epitopes

  • Cross-linking fixatives (paraformaldehyde) at 4% concentration are typically suitable

  • Consider membrane permeabilization steps for accessing intracellular domains

What are recommended Western blotting protocols for TMEM132E detection?

For optimal Western blot detection of TMEM132E:

• Sample preparation:

  • Use lysis buffers containing 0.5-1% detergent suitable for membrane proteins

  • Do not boil samples; instead, heat at 70°C for 10 minutes to prevent aggregation

  • Load 20-50 μg of total protein per lane (may require optimization)

• Gel electrophoresis:

  • Use 8-10% SDS-PAGE gels for optimal resolution of TMEM132E

  • Include molecular weight markers covering the expected size range

• Transfer conditions:

  • Transfer to PVDF membranes (preferred for hydrophobic membrane proteins)

  • Use wet transfer systems with 20% methanol buffer for efficient transfer

  • Transfer at lower voltages for longer times (30V overnight) for more complete transfer

• Blocking and antibody incubation:

  • Block with 5% non-fat dry milk or BSA in TBST for 1-2 hours at room temperature

  • Incubate with primary antibody at recommended dilutions (1:500-2000) overnight at 4°C

  • Wash thoroughly with TBST (at least 3 x 10 minutes)

  • Incubate with appropriate HRP-conjugated secondary antibody

• Detection:

  • Use enhanced chemiluminescence detection systems

  • Begin with shorter exposures and increase as needed

This protocol should be optimized for specific laboratory conditions and antibody characteristics .

What controls are essential when using TMEM132E antibodies?

Essential controls for TMEM132E antibody experiments include:

• Positive controls:

  • Cell lines or tissues known to express TMEM132E based on validated literature

  • Recombinant TMEM132E protein or overexpression systems when available

• Negative controls:

  • Cell lines or tissues with confirmed absence of TMEM132E expression

  • TMEM132E knockdown or knockout samples when available

  • Secondary antibody-only controls to assess non-specific binding

• Specificity controls:

  • Blocking peptide experiments using the immunizing peptide

  • Comparison of staining patterns using antibodies against different TMEM132E epitopes

  • For flow cytometry, include isotype controls matched to the primary antibody's host species and isotype (typically rabbit IgG)

• Procedural controls:

  • Loading controls for Western blotting (β-actin, GAPDH, or membrane protein-specific controls)

  • Tissue processing controls to verify fixation and epitope preservation in IHC/IF

Documentation of these controls is essential for result interpretation and publication.

How can researchers optimize immunohistochemistry protocols for TMEM132E detection?

Optimizing immunohistochemistry for TMEM132E detection requires:

• Fixation optimization:

  • Test multiple fixatives (4% PFA, formalin, Bouin's) with different fixation times

  • For membrane proteins like TMEM132E, shorter fixation times may better preserve epitope accessibility

  • Consider post-fixation storage conditions to prevent epitope degradation

• Antigen retrieval methods:

  • Compare heat-induced epitope retrieval using citrate buffer (pH 6.0) versus EDTA buffer (pH 9.0)

  • Test various retrieval durations (10-30 minutes) and methods (microwave, pressure cooker, water bath)

  • For membrane proteins, enzymatic retrieval with proteases may be beneficial in some cases

• Blocking optimization:

  • Use 5-10% normal serum from the secondary antibody species

  • Add 0.1-0.3% Triton X-100 for membrane permeabilization

  • Consider specialized blocking reagents for tissues with high background

• Antibody conditions:

  • Test dilution series around manufacturer's recommendations (1:500-1000 for HPA070608)

  • Compare room temperature incubation versus overnight at 4°C

  • Optimize diluent composition (BSA concentration, detergent level)

• Detection system selection:

  • For low abundance targets, use high-sensitivity detection systems (HRP-polymer, TSA)

  • Compare DAB versus other chromogens for optimal visualization

  • For co-localization studies, consider fluorescent detection systems

Systematic documentation of optimization variables is essential for reproducible protocols.

What approaches can researchers use to validate TMEM132E antibody specificity?

Comprehensive TMEM132E antibody validation should include:

• Genetic validation:

  • Compare staining in wild-type versus TMEM132E knockdown/knockout models

  • Use siRNA or CRISPR/Cas9 to generate transient or stable knockdowns

  • The specific signal should diminish proportionally to knockdown efficiency

• Peptide competition:

  • Pre-incubate antibody with excess immunizing peptide

  • Run parallel samples with blocked and unblocked antibody

  • Specific signals should be eliminated by peptide competition

• Orthogonal detection methods:

  • Correlate protein detection with mRNA expression data

  • Compare multiple antibodies targeting different TMEM132E epitopes

  • Use epitope-tagged TMEM132E constructs for co-localization studies

• Biochemical validation:

  • Verify molecular weight on Western blots matches predicted size for TMEM132E

  • Consider effects of post-translational modifications on apparent molecular weight

  • For membrane proteins, verify behavior with membrane protein extraction methods

• Cross-species validation:

  • Compare staining patterns in species with high sequence homology

  • Correlate with known evolutionary conservation of TMEM132E

Thorough validation improves confidence in experimental findings and should be documented in publications .

What strategies can improve detection of low-abundance TMEM132E in biological samples?

For enhanced detection of low-abundance TMEM132E:

• Sample enrichment approaches:

  • Perform subcellular fractionation to isolate membrane fractions

  • Use immunoprecipitation to concentrate TMEM132E before analysis

  • Consider tissue or cell types with higher expression levels based on transcriptomic data

• Signal amplification methods:

  • For IHC/ICC: Implement tyramide signal amplification (TSA)

  • For Western blotting: Use high-sensitivity ECL substrates

  • For flow cytometry: Consider multi-layer detection systems or brighter fluorophores

• Optimized extraction methods:

  • Use specialized membrane protein extraction kits

  • Implement mild solubilization conditions to preserve native conformation

  • Concentrate samples using appropriate molecular weight cut-off filters

• Instrumentation considerations:

  • Use high-sensitivity imaging systems (cooled CCD cameras, PMT-based scanners)

  • Optimize exposure settings and gain parameters

  • Consider advanced microscopy techniques (confocal, super-resolution) for localization studies

• Antibody optimization:

  • Increase incubation time (overnight at 4°C)

  • Carefully titrate to determine optimal concentration

  • Consider using cocktails of multiple TMEM132E antibodies targeting different epitopes

Each approach should be systematically tested and optimized for specific experimental conditions .

How can TMEM132E antibodies be employed for studying protein-protein interactions?

To investigate TMEM132E protein-protein interactions:

• Co-immunoprecipitation (Co-IP):

  • Use TMEM132E antibodies for immunoprecipitation under mild conditions

  • Optimize detergent type and concentration to preserve interactions

  • Analyze co-precipitated proteins by Western blotting or mass spectrometry

  • Consider crosslinking to stabilize transient interactions

  • Use multiple antibodies targeting different epitopes to validate interactions

• Proximity labeling approaches:

  • Combine with BioID or APEX2 proximity labeling methods

  • Use antibodies to validate proximity labeling results

  • Compare interactome data across different cellular contexts

• Microscopy-based methods:

  • Perform co-localization studies with candidate interacting proteins

  • Use proximity ligation assay (PLA) to visualize interaction sites in situ

  • Implement FRET/FLIM approaches to confirm direct interactions

• Protein complex analysis:

  • Use native PAGE followed by immunoblotting to identify TMEM132E-containing complexes

  • Implement blue native PAGE for membrane protein complexes

  • Consider mild crosslinking to stabilize complexes during extraction

Data from multiple complementary approaches strengthens confidence in identified interactions.

How should researchers interpret unexpected TMEM132E band patterns in Western blotting?

Interpreting unexpected TMEM132E Western blot patterns:

• Higher molecular weight bands:

  • Potential protein dimers or oligomers: Test with stronger reducing conditions

  • Post-translational modifications: Consider enzymatic treatment (e.g., PNGase F for N-linked glycosylation)

  • Cross-linked complexes: Optimize sample preparation to reduce artifactual crosslinking

  • Incomplete denaturation: Adjust detergent concentration or sample heating conditions

• Lower molecular weight bands:

  • Proteolytic fragments: Increase protease inhibitor concentration

  • Alternative splicing isoforms: Compare with predicted splice variant sizes

  • Degradation products: Prepare fresh samples and minimize processing time

  • Non-specific binding: Perform peptide competition to identify specific bands

• Multiple bands of similar intensity:

  • Post-translational modification variants: Compare with literature on TMEM132E modifications

  • Tissue-specific isoforms: Compare expression patterns across different sample types

  • Cell state-dependent variants: Compare across different treatment conditions

• No bands or very weak signal:

  • Low expression levels: Increase protein loading or use enrichment strategies

  • Epitope masking: Try antibodies targeting different epitopes

  • Incompatible sample preparation: Optimize membrane protein extraction methods

Careful documentation of band patterns aids in interpretation and troubleshooting .

What are common causes of non-specific staining with TMEM132E antibodies and how can they be addressed?

Common causes of non-specific staining and their solutions:

• Insufficient blocking:

  • Increase blocking time (2-3 hours at room temperature or overnight at 4°C)

  • Test different blocking reagents (milk, BSA, commercial blockers)

  • Add 0.1-0.3% Triton X-100 or Tween-20 to reduce hydrophobic interactions

• Antibody concentration issues:

  • Titrate antibody to determine optimal concentration

  • Reduce concentration if background is high while maintaining specific signal

  • Consider longer incubation with more dilute antibody

• Cross-reactivity with similar proteins:

  • Verify antibody specificity through peptide competition

  • Use multiple antibodies targeting different epitopes

  • Compare with genetic knockout/knockdown controls when possible

• Secondary antibody problems:

  • Run secondary-only controls to identify non-specific binding

  • Use highly cross-adsorbed secondary antibodies

  • Match secondary to host species and isotype of primary antibody

• Sample-specific issues:

  • For tissues with high endogenous peroxidase, increase quenching steps

  • For samples with high endogenous biotin, use biotin blocking kits

  • For tissues with high autofluorescence, use specialized quenching methods

• Protocol optimization:

  • Increase washing frequency and duration

  • Use continuous agitation during washing steps

  • Optimize fixation conditions to reduce epitope masking

Systematic troubleshooting focusing on one variable at a time yields best results .

How can researchers distinguish between true TMEM132E signal and artifacts in immunofluorescence studies?

Distinguishing true TMEM132E signal from artifacts:

• Membrane localization pattern:

  • Authentic TMEM132E should show predominantly membrane localization as a single-pass type I membrane protein

  • Compare with established membrane markers to confirm proper localization

  • Cytoplasmic or nuclear staining patterns may indicate non-specific binding or fixation artifacts

• Correlation with expression data:

  • Compare staining intensity with known TMEM132E expression levels in different tissues/cells

  • Correlate with mRNA expression data from public databases

  • Consider cell type-specific expression patterns

• Validation controls:

  • Use peptide competition to confirm specificity

  • Compare with TMEM132E knockdown/knockout samples

  • Test multiple antibodies against different epitopes

• Technical controls:

  • Compare with secondary antibody-only staining

  • Evaluate autofluorescence in unstained samples

  • Use isotype control antibodies to assess non-specific binding

• Pattern analysis:

  • True signals typically show consistent subcellular patterns across different cells

  • Artifacts often appear as irregular, inconsistent, or unusually intense signals

  • Background often shows diffuse patterns lacking subcellular specificity

• Co-localization studies:

  • Confirm co-localization with appropriate membrane compartment markers

  • Verify absence of co-localization with irrelevant cellular structures

Careful image acquisition with appropriate exposure settings and consistent processing is essential for accurate interpretation.

What approaches can resolve discrepancies between different detection methods when studying TMEM132E?

Resolving discrepancies between detection methods:

• Method-specific considerations:

  • Western blot detects denatured protein; antibody may recognize epitopes hidden in native conformation

  • IHC/IF preserves spatial information but may be affected by fixation artifacts

  • Flow cytometry requires single-cell suspensions which may alter membrane protein presentation

• Epitope accessibility differences:

  • Try multiple antibodies targeting different epitopes

  • Consider native versus denatured protein recognition

  • Test different fixation and permeabilization protocols

• Expression level thresholds:

  • Different methods have varying sensitivity thresholds

  • Implement signal amplification for less sensitive methods

  • Consider enrichment steps for low-abundance targets

• Quantitative comparison approaches:

  • Standardize quantification methods across techniques

  • Use calibration standards when possible

  • Normalize to appropriate controls for each method

• Orthogonal validation:

  • Implement genetic approaches (overexpression, knockdown)

  • Use tagged constructs for orthogonal detection

  • Correlate with mRNA expression analysis

• Technical optimization:

  • Systematically optimize each method independently

  • Document all protocol variations

  • Consider professional technical assistance for challenging applications

When methods yield different results, the combined data often provides more complete biological insights than any single approach.

How might researchers utilize TMEM132E antibodies for studying disease associations?

Utilizing TMEM132E antibodies in disease research:

• Expression analysis in pathological samples:

  • Compare TMEM132E levels in normal versus diseased tissues

  • Correlate expression with disease progression or severity

  • Analyze subcellular redistribution in pathological states

• Biomarker development:

  • Evaluate TMEM132E as a potential diagnostic or prognostic marker

  • Develop quantitative assays using validated antibodies

  • Correlate with other established biomarkers

• Functional studies:

  • Investigate how disease conditions affect TMEM132E localization and processing

  • Analyze changes in TMEM132E-containing protein complexes

  • Study potential alterations in post-translational modifications

• Therapeutic target assessment:

  • Use antibodies to evaluate TMEM132E accessibility in intact cells

  • Develop blocking or neutralizing antibodies if functionally relevant

  • Monitor TMEM132E expression changes in response to therapeutic interventions

• High-throughput screening:

  • Implement antibody-based assays for screening therapeutic compounds

  • Develop cell-based reporter systems incorporating TMEM132E antibodies

  • Validate hits with orthogonal detection methods

Research-grade antibodies provide valuable tools for initial discovery, while more rigorous validation would be required for clinical applications .

What emerging technologies might enhance TMEM132E antibody applications in research?

Emerging technologies enhancing TMEM132E antibody applications:

• Advanced imaging approaches:

  • Super-resolution microscopy (STORM, PALM, STED) for nanoscale localization

  • Expansion microscopy for improved spatial resolution

  • Lightsheet microscopy for 3D tissue analysis with minimal photobleaching

  • Correlative light and electron microscopy for ultrastructural context

• Single-cell analysis methods:

  • Mass cytometry (CyTOF) for high-parameter single-cell profiling

  • Imaging mass cytometry for spatial proteomics

  • Single-cell Western blotting for protein heterogeneity analysis

  • Microfluidic antibody-based capture systems

• Spatial proteomics approaches:

  • Digital spatial profiling for quantitative spatial analysis

  • Multiplexed ion beam imaging (MIBI) for high-parameter tissue imaging

  • In situ sequencing of antibody-DNA conjugates

  • Multiplexed immunofluorescence with iterative staining or spectral unmixing

• Structural biology integration:

  • Proximity labeling combined with structural analysis

  • Antibody epitope mapping with hydrogen-deuterium exchange mass spectrometry

  • Integrating cryo-EM data with antibody binding sites

• Artificial intelligence applications:

  • Machine learning for automated image analysis

  • Pattern recognition in complex multiplexed datasets

  • Predictive modeling of antibody-epitope interactions

These emerging technologies can significantly enhance the information obtained from TMEM132E antibody studies beyond traditional applications .

What strategies might improve standardization and reproducibility in TMEM132E antibody-based research?

Strategies for improved standardization and reproducibility:

• Comprehensive antibody validation:

  • Implement multi-method validation protocols

  • Document all validation experiments and results

  • Use genetic controls (knockout/knockdown) when available

  • Share validation data through repositories or supplementary materials

• Detailed protocol documentation:

  • Report complete experimental conditions (buffers, incubation times, temperatures)

  • Specify exact antibody catalog numbers, lots, and concentrations

  • Document all optimization steps and negative results

  • Use protocol repositories (protocols.io) for comprehensive method sharing

• Reference materials and controls:

  • Develop shared positive and negative control samples

  • Create reference images for staining pattern comparison

  • Establish quantitative standards for expression analysis

  • Use spike-in controls for assay normalization

• Collaborative validation efforts:

  • Participate in multi-laboratory validation studies

  • Compare results across different antibody sources

  • Implement antibody validation reporting standards

  • Contribute to antibody validation databases

• Transparent reporting:

  • Include all necessary controls in publications

  • Report antibody validation methods in materials and methods

  • Disclose limitations and potential caveats

  • Use reporting guidelines (e.g., ARRIVE for animal studies)

Improved standardization enhances data reliability and facilitates comparison across studies .

How should researchers integrate multiple TMEM132E antibody-based approaches for comprehensive protein characterization?

Integrating multiple antibody-based approaches provides the most comprehensive characterization of TMEM132E. Researchers should employ a multi-method strategy that combines:

The integration of these approaches, particularly when utilizing antibodies targeting different epitopes, provides cross-validation and generates a more complete understanding of TMEM132E biology than any single method alone.

What are the critical considerations for interpreting TMEM132E antibody-based research findings?

Critical considerations for interpreting TMEM132E antibody-based research include:

• Antibody validation status: Always consider the level of validation for any antibody used, including specificity controls, genetic validation, and cross-method verification. Inadequate validation can lead to misinterpretation of results .

• Technical limitations: Each detection method has inherent limitations – Western blotting loses spatial information, IHC may be affected by fixation artifacts, and flow cytometry requires cell dissociation. Understanding these limitations is essential for proper interpretation .

• Biological context: TMEM132E expression, localization, and function may vary across tissues, cell types, developmental stages, and disease states. Findings should be interpreted within the specific biological context studied .

• Quantitative considerations: Assess whether the methods used are truly quantitative, semi-quantitative, or qualitative. Appropriate statistical analysis should be applied based on the nature of the data .

• Reproducibility factors: Consider whether findings have been replicated across multiple antibodies, detection methods, experimental models, and laboratories. Consistent findings across diverse approaches strengthen confidence in the results .