tmem151b Antibody

What is TMEM151B and what is its biological function?

TMEM151B (Transmembrane protein 151B) is believed to be an integral component of the cell membrane . It is encoded by the TMEM151B gene (Gene ID: 441151) and has the UniProt accession number Q8IW70 . While the specific biological function of TMEM151B remains under investigation, its transmembrane nature suggests potential roles in membrane transport, cellular signaling, or structural support. Researchers should note that despite a calculated molecular weight of approximately 62 kDa, the observed molecular weight in experimental contexts is often around 28 kDa, indicating possible post-translational modifications or alternative splicing events .

What applications are TMEM151B antibodies validated for?

TMEM151B antibodies from commercial sources have been validated for several research applications. Polyclonal antibodies from Proteintech (catalog #31682-1-AP) are validated for Western Blot (WB) and ELISA applications, with demonstrated reactivity against human samples . Atlas Antibodies/Sigma-Aldrich rabbit polyclonal antibodies (HPA055167) are validated for immunohistochemistry (IHC) with recommended dilutions of 1:50-1:200 . For comprehensive experimental design, researchers should consider that different antibodies may vary in their specific epitope recognition and validation status across applications.

What tissue or cell types are best for studying TMEM151B expression?

Based on validation data, TMEM151B antibodies have shown positive Western blot detection in several human cell lines including K-562 cells, SH-SY5Y cells, and TT cells . When designing experiments to study TMEM151B expression, researchers should consider these cell types as positive controls. Additionally, the appropriate sample types for TMEM151B detection include tissue homogenates, cell lysates, and other biological fluids as indicated in ELISA kit specifications .

What is the recommended protocol for Western blot detection of TMEM151B?

For optimal Western blot detection of TMEM151B, the following methodology is recommended:

• Sample preparation: Prepare protein extracts from human cell lines (K-562, SH-SY5Y, or TT cells serve as positive controls) .

• Gel electrophoresis: Use standard SDS-PAGE protocols.

• Transfer: Transfer proteins to PVDF or nitrocellulose membrane using standard protocols.

• Blocking: Block membrane with appropriate blocking buffer.

• Primary antibody: Dilute TMEM151B antibody at 1:500-1:2000 in blocking buffer .

• Secondary antibody: Use appropriate HRP-conjugated secondary antibody.

• Detection: Visualize using chemiluminescence.

• Expected results: Look for a band at approximately 28 kDa, which is the observed molecular weight despite the calculated weight of 62 kDa .

This protocol may need to be optimized based on specific laboratory conditions and the particular antibody used.

How should immunohistochemistry be performed with TMEM151B antibodies?

For immunohistochemistry applications using TMEM151B antibodies:

• Tissue preparation: Use formalin-fixed, paraffin-embedded tissue sections.

• Antigen retrieval: May be required depending on fixation method.

• Blocking: Block endogenous peroxidase activity and non-specific binding.

• Primary antibody: Apply TMEM151B antibody at dilutions of 1:50-1:200 .

• Detection system: Use an appropriate detection system compatible with rabbit primary antibodies.

• Counterstaining: Apply hematoxylin or other appropriate counterstain.

• Mounting: Mount with appropriate medium.

Researchers should note that optimal dilutions may vary depending on the specific antibody and tissue type, necessitating optimization for each experimental setup.

What are the parameters for TMEM151B detection using ELISA?

For quantitative measurement of Human TMEM151B using ELISA kits:

Researchers should follow specific kit instructions for sample preparation, dilution, and assay procedure. It's recommended that samples be diluted to fall within the mid-range of the kit's detection range for optimal results .

How does the discrepancy between calculated and observed molecular weight of TMEM151B impact experimental design?

The discrepancy between TMEM151B's calculated molecular weight (62 kDa) and observed molecular weight in Western blots (28 kDa) presents an important consideration for experimental design and data interpretation. This difference may be attributed to:

• Post-translational modifications (PTMs): Possible proteolytic processing.

• Alternative splicing: Expression of shorter isoforms.

• Protein folding: Compact folding leading to faster migration on SDS-PAGE.

When designing experiments, researchers should:

• Include appropriate molecular weight markers spanning both expected weights

• Consider using multiple antibodies targeting different epitopes

• Validate identity through additional techniques (mass spectrometry, immunoprecipitation)

• Include controls to rule out non-specific binding

This discrepancy highlights the importance of careful validation and characterization of protein identity in TMEM151B studies.

What cross-reactivity considerations should be made when using TMEM151B antibodies?

When using TMEM151B antibodies, researchers should be aware of potential cross-reactivity issues:

• Species reactivity: Available antibodies primarily show reactivity with human samples . Cross-reactivity with mouse or rat TMEM151B has not been extensively documented in the provided search results.

• Epitope specificity: The immunogen sequence used for the Sigma-Aldrich antibody (CWHCQARHELQHRVDVSSVRERVGRMQQATPCIWWKAISYH) should be compared with sequences of other proteins when assessing potential cross-reactivity.

• Validation across applications: While validated for specific applications (WB, ELISA, IHC), performance may vary across different experimental contexts.

Researchers should perform appropriate controls including:

• Peptide competition assays

• Knockout/knockdown validation

• Multiple antibody validation using antibodies targeting different epitopes

How can TMEM151B expression be quantified across different experimental systems?

For consistent quantification of TMEM151B expression across different experimental systems, researchers should consider a multi-method approach:

• Western blot quantification:

  • Use standardized loading controls (β-actin, GAPDH)

  • Apply densitometric analysis

  • Prepare standard curves using recombinant protein

• qPCR for mRNA expression:

  • Design primers specific to TMEM151B transcripts

  • Normalize to appropriate reference genes

  • Account for potential splice variants

• ELISA-based quantification:

  • For absolute quantification within the range 0.156-10 ng/ml

  • Ensure samples fall within linear range

  • Prepare standard curves with recombinant TMEM151B

• Immunohistochemistry quantification:

  • Use digital image analysis for semi-quantitative assessment

  • Apply H-score or similar scoring systems

  • Include appropriate positive and negative controls

Cross-platform validation enhances confidence in quantitative assessments of TMEM151B expression levels.

What are common issues encountered when detecting TMEM151B in Western blots?

Researchers may encounter several challenges when detecting TMEM151B via Western blot:

• Molecular weight discrepancy: Expected at 62 kDa but often observed at 28 kDa . Solution: Include a broad range of molecular weight markers.

• Weak signal: May be due to low expression levels. Solutions:

  • Increase protein loading (50-100 μg total protein)

  • Optimize antibody concentration (test range 1:500-1:2000)

  • Extend primary antibody incubation (overnight at 4°C)

  • Use enhanced chemiluminescence detection

• Non-specific bands: Solutions:

  • Optimize blocking conditions

  • Increase washing stringency

  • Test different antibody dilutions

  • Consider using fresh samples to minimize degradation

• Background issues: Solutions:

  • Increase blocking time/concentration

  • Add 0.1-0.5% Tween-20 to washing buffers

  • Reduce secondary antibody concentration

Systematic optimization of these parameters can significantly improve TMEM151B detection.

How should contradictory results between different detection methods be resolved?

When faced with contradictory results between different detection methods for TMEM151B:

• Evaluate antibody validation status:

  • Verify that each antibody has been validated for the specific application

  • Check if different antibodies target different epitopes

  • Review batch-specific validation data

• Consider protein modifications:

  • Post-translational modifications may affect epitope accessibility

  • Different detection methods may have varying sensitivity to modified proteins

• Implement orthogonal validation approaches:

  • Perform knockdown/knockout validation

  • Use mass spectrometry for protein identification

  • Apply multiple antibodies targeting different epitopes

  • Conduct peptide competition assays

• Assess experimental conditions:

  • Cell/tissue preparation methods

  • Buffer compositions

  • Sample handling and storage

Contradictory results often provide valuable insights into protein behavior and can lead to new discoveries about TMEM151B biology.

What controls are essential for validating TMEM151B antibody specificity?

To properly validate TMEM151B antibody specificity, researchers should implement these essential controls:

• Positive controls:

  • Cell lines with confirmed TMEM151B expression (K-562, SH-SY5Y, TT cells)

  • Recombinant TMEM151B protein

  • Tissues with known expression patterns

• Negative controls:

  • TMEM151B knockout/knockdown samples

  • Cell lines with negligible expression

  • Secondary antibody-only controls

  • Isotype controls

• Specificity controls:

  • Peptide competition/neutralization assays using the immunogen

  • Multiple antibodies targeting different epitopes

  • Correlation between protein and mRNA expression patterns

• Technical controls:

  • Loading controls for Western blots

  • Tissue controls for IHC

  • Standard curves for ELISA

Implementing these controls systematically increases confidence in experimental observations and reduces the risk of misinterpreting TMEM151B data.

What are emerging techniques for studying TMEM151B localization and function?

Emerging techniques that could advance TMEM151B research include:

• Advanced microscopy approaches:

  • Super-resolution microscopy for precise subcellular localization

  • Live-cell imaging with fluorescently tagged TMEM151B

  • Correlative light and electron microscopy (CLEM)

• Proximity labeling techniques:

  • BioID or APEX2 fusions to identify proximal proteins

  • Mapping TMEM151B protein interaction networks

• Functional genomics:

  • CRISPR-Cas9 genome editing for knockout/knockin studies

  • Single-cell transcriptomics to analyze expression patterns

• Structural biology approaches:

  • Cryo-EM to determine membrane protein structure

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

These advanced methodologies can provide deeper insights into TMEM151B function beyond traditional antibody-based detection methods.

How can researchers assess the biological significance of TMEM151B in their experimental systems?

To assess the biological significance of TMEM151B, researchers should consider a multi-faceted approach:

• Expression analysis:

  • Quantify TMEM151B levels across different tissues/cell types

  • Examine expression changes during development, differentiation, or disease

  • Correlate expression with biological phenotypes

• Loss-of-function studies:

  • CRISPR knockout models

  • RNAi-mediated knockdown

  • Dominant negative approaches

• Gain-of-function studies:

  • Overexpression systems

  • Inducible expression models

  • Rescue experiments in knockout backgrounds

• Interaction studies:

  • Co-immunoprecipitation to identify binding partners

  • Proximity labeling to map interaction networks

  • Colocalization studies with known membrane proteins

• Physiological relevance:

  • Correlation with disease states or cellular processes

  • Phenotypic assays following manipulation of TMEM151B levels

  • Animal models where appropriate

Integration of these approaches provides a comprehensive assessment of TMEM151B's biological significance.