tmem168a Antibody

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

TMEM168A antibody is a polyclonal antibody targeting the TMEM168 protein, a multi-pass transmembrane protein involved in regulating cellular signaling pathways such as Wnt/β-catenin . TMEM168 is implicated in cancer progression, particularly in glioblastoma (GBM) and other solid tumors, where its overexpression correlates with poor prognosis . The antibody enables researchers to investigate TMEM168's expression, localization, and functional roles in disease models.

Antibody Structure and Development

  • Host species: Rabbit .

  • Immunogen: A fusion protein or peptide sequence derived from TMEM168 (e.g., residues VLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVK) .

  • Class/Isotype: IgG .

  • Molecular weight: Observed at 110–130 kDa via Western blot (higher than the predicted 80 kDa due to post-translational modifications) .

Key Uses

ApplicationDilution RangeValidated Species
Western blot (WB)1:1,000–1:4,000Human, mouse, rat
Immunohistochemistry (IHC)1:20–1:200Human tissues
Immunofluorescence (IF)Not specifiedHuman cell lines

Research Findings

  • Cancer Biology:

    • TMEM168 knockdown in glioblastoma cells (U87, U373) reduces proliferation, induces apoptosis, and suppresses Wnt/β-catenin signaling by downregulating β-catenin, cyclin D1, and survivin .

    • High TMEM168 expression in GBM correlates with shorter patient survival .

  • Signaling Pathways:

    • TMEM168 interacts with EGFR/HER2 in head and neck squamous cell carcinoma (HNSCC), promoting tumor growth .

Mechanistic Studies

  • TMEM168 in Glioblastoma:

    • siRNA-mediated TMEM168 silencing in GBM cells arrests the cell cycle at G0/G1 and reduces tumorigenicity in xenograft models .

    • Lithium chloride (LiCl), a Wnt activator, reverses TMEM168 knockdown effects, confirming pathway dependency .

Clinical Relevance

  • TMEM168 is a potential biomarker for therapeutic resistance in EGFR/HER2-targeted therapies .

  • Its role in chemoresistance and epithelial-mesenchymal transition (EMT) highlights its utility in studying metastasis .

Protocol Considerations

  • Storage: -20°C in aliquots with glycerol .

  • Antigen Retrieval: Use TE buffer (pH 9.0) or citrate buffer (pH 6.0) for IHC .

Limitations and Future Directions

Product Specs

Buffer
Preservative: 0.03% Proclin 300
Constituents: 50% Glycerol, 0.01M Phosphate Buffered Saline (PBS), pH 7.4
Form
Liquid
Lead Time
Made-to-order (14-16 weeks)
Synonyms
tmem168a antibody; si:dkey-192l17.1 antibody; Transmembrane protein 168-A antibody
Target Names
tmem168a
Uniprot No.

Target Background

Database Links

KEGG: dre:100034546

UniGene: Dr.140177

Protein Families
TMEM168 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM168 and why are antibodies against it important for research?

TMEM168 (Transmembrane Protein 168) is a multi-pass membrane protein encoded by the TMEM168 gene. Antibodies targeting this protein are valuable research tools for investigating membrane protein localization, function, and interactions in various biological systems. TMEM168 antibodies enable researchers to detect, visualize, and quantify this protein across multiple experimental platforms, providing insights into its biological roles and potential implications in cellular processes and disease states . These antibodies have demonstrated reactivity across multiple species including human, mouse, rat, and other mammals, allowing for comparative studies across model organisms .

What applications are TMEM168 antibodies validated for?

TMEM168 antibodies have been validated for several research applications, primarily Western Blotting (WB), which allows for detection and semi-quantitative analysis of the protein in cell or tissue lysates . Additionally, certain TMEM168 antibodies have been validated for immunohistochemistry (IHC) and immunocytochemistry/immunofluorescence (ICC-IF), enabling the visualization of protein localization within tissues and cells respectively . Some antibodies also demonstrate utility in enzyme immunoassays (EIA) and flow cytometry (FACS), expanding their research applications beyond traditional protein detection methods . When selecting a TMEM168 antibody, researchers should verify the specific applications for which each antibody has been validated to ensure appropriate experimental usage.

How should researchers select the appropriate TMEM168 antibody for their specific experimental needs?

Selection of an appropriate TMEM168 antibody requires careful consideration of several factors:

  • Target specificity: Determine which epitope or region of TMEM168 you need to target. Some antibodies recognize specific amino acid sequences (e.g., AA 578-627 or AA 558-587), which may be important depending on your research question .

  • Species reactivity: Confirm that the antibody reacts with the species you're studying. Available TMEM168 antibodies show varying cross-reactivity patterns across species such as human, mouse, rat, and others .

  • Application compatibility: Ensure the antibody is validated for your intended application (WB, IHC, ICC-IF, etc.) .

  • Clonality: Choose between polyclonal antibodies (which recognize multiple epitopes) and monoclonal antibodies (which recognize a single epitope) based on your specific requirements for sensitivity versus specificity .

  • Validation data: Review available validation data for each antibody, including images of expected staining patterns and molecular weight confirmation .

This systematic evaluation process enables researchers to select the most appropriate TMEM168 antibody for their specific experimental context and research objectives.

What controls should be included when using TMEM168 antibodies in research?

Proper experimental controls are essential when working with TMEM168 antibodies:

  • Positive control: Include samples known to express TMEM168 (based on literature or database information) to confirm antibody functionality.

  • Negative control: Incorporate samples where TMEM168 is absent or knocked down to verify antibody specificity.

  • Isotype control: For applications like flow cytometry or IHC, include an irrelevant antibody of the same isotype (e.g., rabbit IgG for rabbit polyclonal TMEM168 antibodies) to identify non-specific binding .

  • Secondary antibody only control: Omit the primary TMEM168 antibody but include the secondary antibody to detect background signal from the secondary antibody alone.

  • Peptide competition assay: Pre-incubate the TMEM168 antibody with the immunizing peptide (if available) to demonstrate binding specificity.

These controls help validate experimental results and provide confidence in the specificity and accuracy of TMEM168 detection across research applications.

How can researchers verify the specificity of TMEM168 antibodies in their experimental system?

Verifying antibody specificity is a critical step in ensuring reliable research outcomes. For TMEM168 antibodies, researchers should implement a multi-faceted validation approach:

  • Genetic validation: Use CRISPR/Cas9 gene editing or siRNA-mediated knockdown to create TMEM168-depleted samples, which should show reduced or absent signal compared to wild-type samples.

  • Peptide competition assays: Pre-incubate the antibody with the immunizing peptide (often a synthetic peptide from amino acids 578-627 of human TMEM168) before application . Specific binding will be blocked by the peptide, resulting in signal reduction.

  • Recombinant protein expression: Overexpress tagged TMEM168 in a model system and confirm co-localization or detection with both the TMEM168 antibody and an antibody against the tag.

  • Cross-validation with multiple antibodies: Use different antibodies targeting distinct epitopes of TMEM168 to confirm consistent detection patterns.

  • Mass spectrometry validation: Perform immunoprecipitation with the TMEM168 antibody followed by mass spectrometry to confirm the identity of the precipitated protein.

This comprehensive validation strategy helps researchers confirm that their TMEM168 antibody specifically detects the intended target protein in their experimental system, minimizing the risk of misinterpretation due to non-specific binding .

What methodological approaches can address cross-reactivity issues with TMEM168 antibodies?

Cross-reactivity represents a significant challenge when working with antibodies. To address potential cross-reactivity with TMEM168 antibodies:

  • Epitope analysis: Review the sequence homology between the immunizing peptide (e.g., aa578-627 of human TMEM168) and other proteins using BLAST analysis . The high sequence conservation across species (100% identity across many mammals) suggests potential cross-reactivity with homologous proteins .

  • Absorption protocols: Implement pre-absorption of the antibody with recombinant proteins or cell lysates from organisms lacking TMEM168 to remove antibodies with affinity for unrelated epitopes.

  • Computational modeling: Utilize biophysics-informed models to predict cross-reactivity based on binding energetics, which can help identify antibodies with optimal specificity profiles .

  • Titration optimization: Determine the minimum antibody concentration that provides specific signal while minimizing background, as cross-reactivity often manifests at higher antibody concentrations.

  • Modified blocking protocols: Test different blocking agents (BSA, milk, serum) and conditions to reduce non-specific binding.

These methodological refinements can significantly enhance experimental specificity and reliability when working with TMEM168 antibodies .

How can advanced computational approaches improve TMEM168 antibody specificity prediction?

Recent advances in computational biology have enabled more sophisticated approaches to antibody specificity prediction and design:

  • Biophysics-informed modeling: These models associate distinct binding modes with specific ligands, allowing for the prediction and generation of antibody variants with customized specificity profiles . For TMEM168 antibodies, such models could predict cross-reactivity with closely related proteins or across species.

  • Machine learning integration: Combining high-throughput sequencing data with machine learning algorithms enables predictions beyond experimentally observed sequences . This approach can identify subtle patterns in antibody-antigen interactions that influence specificity.

  • Binding mode disentanglement: Computational models can distinguish between different binding modes, even when associated with chemically similar epitopes . This capability is particularly valuable for designing TMEM168 antibodies that can discriminate between closely related transmembrane proteins.

  • Experimental data incorporation: Models trained on phage display experimental data can infer multiple physical properties, including specificity profiles not directly measured in experiments .

  • Specificity optimization algorithms: Computational approaches can optimize antibody sequences to either minimize cross-reactivity with undesired targets or enhance cross-specificity across desired targets (such as TMEM168 homologs in different species) .

These computational approaches offer promising tools for designing next-generation TMEM168 antibodies with enhanced specificity characteristics .

What are the optimal protocols for using TMEM168 antibodies in Western blotting applications?

Western blotting with TMEM168 antibodies requires careful optimization:

  • Sample preparation: TMEM168 is a transmembrane protein, necessitating effective membrane protein extraction protocols. Use specialized lysis buffers containing appropriate detergents (e.g., NP-40, Triton X-100, or CHAPS) to solubilize membrane proteins effectively.

  • Protein denaturation: Heat samples at 70°C rather than 95°C to prevent transmembrane protein aggregation, which can affect migration and detection.

  • Loading controls: Include appropriate loading controls specific for membrane proteins (e.g., Na⁺/K⁺ ATPase) rather than cytosolic proteins.

  • Transfer optimization: Implement extended transfer times or specialized transfer systems designed for hydrophobic membrane proteins like TMEM168.

  • Blocking optimization: Test different blocking agents (5% milk, 3-5% BSA) to determine which provides optimal signal-to-background ratio with your specific TMEM168 antibody.

  • Antibody dilution: Begin with manufacturer-recommended dilutions (typically 1:500 to 1:2000) and optimize as needed for your specific samples .

  • Detection system selection: Choose between chemiluminescence, fluorescence, or chromogenic detection based on your sensitivity requirements and available equipment.

This methodological approach maximizes the chances of successful TMEM168 detection while minimizing background interference and non-specific binding .

What strategies can enhance TMEM168 antibody performance in immunohistochemistry and immunofluorescence?

Optimizing TMEM168 antibody performance in imaging applications involves several key considerations:

  • Fixation method selection: Test multiple fixation protocols (4% paraformaldehyde, methanol, or acetone) to determine which best preserves TMEM168 epitopes while maintaining cellular architecture.

  • Antigen retrieval optimization: For formalin-fixed paraffin-embedded tissues, compare heat-induced epitope retrieval methods (citrate buffer pH 6.0 vs. EDTA buffer pH 9.0) to maximize epitope accessibility.

  • Permeabilization adjustment: Since TMEM168 is a transmembrane protein, optimize membrane permeabilization steps (varying detergent type and concentration) to ensure antibody access while preserving membrane structure.

  • Signal amplification systems: Consider tyramide signal amplification or other amplification systems for low-abundance TMEM168 detection.

  • Co-localization markers: Include established markers for cellular compartments (ER, Golgi, plasma membrane) to confirm the expected subcellular localization of TMEM168.

  • Confocal microscopy parameters: Adjust laser power, detector gain, and pinhole settings to optimize signal-to-noise ratio for TMEM168 detection.

  • Image analysis standardization: Implement consistent image analysis protocols to quantify TMEM168 expression levels across experimental conditions.

These methodological refinements can significantly improve the quality and reliability of TMEM168 visualization in tissue and cellular contexts .

How should researchers approach epitope mapping for TMEM168 antibodies?

Epitope mapping provides crucial information about antibody-antigen interactions and can guide experimental design:

  • Peptide array analysis: Use overlapping peptide arrays spanning the TMEM168 sequence to identify specific binding regions, particularly focusing on the sequences used as immunogens (e.g., aa578-627) .

  • Deletion mutant generation: Create a series of TMEM168 deletion constructs to narrow down the antibody binding region through expression and detection experiments.

  • Site-directed mutagenesis: Once a potential epitope region is identified, introduce specific amino acid substitutions to pinpoint critical residues for antibody recognition.

  • Cross-species reactivity analysis: Compare TMEM168 sequences across species with known reactivity patterns to identify conserved epitopes. For example, the high conservation (100% identity) across mammals and 92% identity with chicken TMEM168 in the aa578-627 region suggests this sequence contains highly conserved epitopes .

  • Structural prediction integration: Incorporate protein structure predictions to assess epitope accessibility in the native protein conformation.

  • Competitive binding assays: Use a panel of monoclonal antibodies with different epitope specificities to determine if your antibody competes for the same binding site.

This systematic approach to epitope mapping enhances understanding of antibody specificity and guides optimal experimental application of TMEM168 antibodies .

How should researchers interpret discrepancies in TMEM168 antibody results across different experimental techniques?

When facing discrepancies in TMEM168 detection across different methods:

  • Epitope accessibility analysis: Different techniques (WB, IHC, ICC-IF) vary in how they expose epitopes. The TMEM168 antibody's target epitope (e.g., aa578-627) may be differently accessible in denatured (WB) versus native (IF) conditions .

  • Post-translational modification impact: Consider whether post-translational modifications might mask epitopes in some experimental contexts but not others.

  • Protocol-specific optimization: Recognize that optimal antibody dilutions and conditions may differ significantly between applications. Systematic titration in each method is essential.

  • Isoform-specific detection: Evaluate whether discrepancies might result from differential detection of TMEM168 isoforms across methods.

  • Cross-validation approach: When possible, confirm findings using orthogonal methods or multiple antibodies targeting different TMEM168 epitopes.

  • Sample preparation effects: Assess whether differences in sample preparation (particularly for membrane proteins like TMEM168) might explain discrepancies.

What methodological approaches can help resolve contradictory findings with TMEM168 antibodies in the literature?

Resolving contradictory literature findings requires systematic investigation:

  • Antibody characterization comparison: Compare the specific antibodies used across studies, noting differences in immunogen sequence (e.g., aa578-627 versus aa558-587), clonality, and validation methods .

  • Binding mode analysis: Apply computational approaches to determine whether different antibodies might recognize distinct binding modes or conformational states of TMEM168 .

  • Replication with standardized protocols: Implement standardized protocols across different antibodies to determine whether methodological differences explain contradictory findings.

  • Genetic validation integration: Incorporate genetic approaches (CRISPR knockout, siRNA) to definitively validate antibody specificity in the experimental systems where contradictions exist.

  • Meta-analysis framework: Develop a systematic framework for comparing antibody performance across studies, accounting for differences in experimental conditions, cell types, and detection methods.

  • Collaborative validation: Establish multi-laboratory validation studies using identical antibody lots and protocols to resolve discrepancies.

This multi-faceted approach addresses the complexity of antibody-based research and helps establish consensus regarding TMEM168 biology across different experimental systems .

What statistical methods are appropriate for quantifying TMEM168 expression levels across experimental conditions?

Robust statistical analysis of TMEM168 expression requires:

  • Normalization strategy selection: Choose appropriate normalization methods for the experimental technique (housekeeping proteins for WB, reference genes for qPCR, internal standards for proteomics).

  • Technical replicate analysis: Implement statistical methods that account for both technical variability (within-sample variation) and biological variability (between-sample variation).

  • Non-parametric testing consideration: Since antibody-based quantification often produces non-normally distributed data, consider non-parametric statistical tests when appropriate.

  • Hierarchical linear modeling: For complex experimental designs with multiple variables, implement hierarchical models that can account for nested factors.

  • Bayesian approaches: Consider Bayesian statistical frameworks that can incorporate prior knowledge about TMEM168 expression patterns.

  • Machine learning integration: For image-based quantification of TMEM168 expression, implement machine learning algorithms to reduce subjective bias in quantification.

  • Effect size reporting: Report standardized effect sizes alongside p-values to communicate the magnitude of TMEM168 expression changes.

These statistical approaches enhance the rigor and reproducibility of quantitative analyses involving TMEM168 antibodies across research applications.

How might next-generation antibody technologies enhance TMEM168 detection and characterization?

Emerging technologies offer promising avenues for improved TMEM168 research:

  • Single-chain variable fragment (scFv) development: Engineering smaller antibody fragments could enhance penetration into tissues and access to restricted epitopes within TMEM168's transmembrane domains.

  • Nanobody applications: Development of camelid-derived single-domain antibodies (nanobodies) against TMEM168 could provide improved access to sterically hindered epitopes and enhanced specificity.

  • Bispecific antibody design: Creation of bispecific antibodies that simultaneously target TMEM168 and interaction partners could enable direct visualization of protein complexes and functional relationships.

  • Proximity labeling integration: Combining TMEM168 antibodies with proximity labeling techniques (BioID, APEX) could map the protein's interactome with subcellular resolution.

  • Super-resolution microscopy optimization: Developing TMEM168 antibodies specifically optimized for super-resolution microscopy techniques would enable nanoscale visualization of its distribution and dynamics.

  • Computationally designed specificity: Application of biophysics-informed models could generate antibodies with precisely engineered specificity profiles for TMEM168, either enhancing specific binding or enabling controlled cross-reactivity with related proteins .

These technological advances promise to expand our understanding of TMEM168 biology and function across diverse experimental contexts .

What experimental approaches can elucidate TMEM168 function through antibody-based techniques?

Advanced functional studies of TMEM168 can leverage antibody-based approaches:

  • Proximity-dependent biotinylation: Using TMEM168 antibodies in combination with BioID or APEX2 techniques to identify proximal proteins in living cells.

  • Antibody-mediated protein degradation: Applying targeted protein degradation technologies (e.g., PROTAC) conjugated to TMEM168 antibodies to study the consequences of acute protein depletion.

  • Intrabody expression: Developing TMEM168-specific intrabodies for visualization and perturbation of the protein in living cells.

  • Epitope-specific functional blocking: Creating antibodies that target functional domains of TMEM168 to disrupt specific protein interactions or activities.

  • Conformation-specific detection: Generating antibodies that recognize distinct conformational states of TMEM168 to study its activation or regulatory mechanisms.

  • Antibody-guided proteomics: Using TMEM168 antibodies for immunoprecipitation followed by mass spectrometry to comprehensively map interaction networks.

These approaches represent the cutting edge of antibody-based functional studies and offer powerful tools for investigating TMEM168's biological roles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.